Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

D5GKE9

Protein Details
Accession D5GKE9    Localization Confidence Medium Confidence Score 12.1
NoLS Segment(s)
PositionSequenceProtein Nature
75-104GQPPRLLPRHLRCRRRRSRRSLPTSCRSPGHydrophilic
NLS Segment(s)
PositionSequence
88-93RRRRSR
Subcellular Location(s) nucl 14.5, cyto_nucl 9.5, mito 8, cyto 3.5
Family & Domain DBs
KEGG tml:GSTUM_00009506001  -  
Amino Acid Sequences MANSIPPAFAVAAQPRQGVGLCQGYPQYLRATNAEKPGQKSGEYQLCEPGQFHPSSSPSLLDTFCSLQTYRLRSGQPPRLLPRHLRCRRRRSRRSLPTSCRSPGPAFPFDISSPCRIVPVLPP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.22
3 0.23
4 0.23
5 0.19
6 0.17
7 0.18
8 0.16
9 0.17
10 0.18
11 0.18
12 0.19
13 0.19
14 0.19
15 0.17
16 0.18
17 0.2
18 0.24
19 0.27
20 0.32
21 0.36
22 0.36
23 0.37
24 0.4
25 0.38
26 0.35
27 0.34
28 0.34
29 0.35
30 0.33
31 0.3
32 0.3
33 0.29
34 0.28
35 0.26
36 0.21
37 0.18
38 0.16
39 0.16
40 0.14
41 0.15
42 0.16
43 0.16
44 0.15
45 0.12
46 0.13
47 0.13
48 0.11
49 0.11
50 0.1
51 0.1
52 0.11
53 0.1
54 0.13
55 0.16
56 0.19
57 0.2
58 0.23
59 0.25
60 0.28
61 0.37
62 0.41
63 0.43
64 0.45
65 0.48
66 0.5
67 0.52
68 0.55
69 0.56
70 0.59
71 0.64
72 0.68
73 0.72
74 0.79
75 0.86
76 0.89
77 0.9
78 0.89
79 0.91
80 0.92
81 0.92
82 0.92
83 0.9
84 0.88
85 0.84
86 0.76
87 0.68
88 0.62
89 0.55
90 0.51
91 0.49
92 0.43
93 0.39
94 0.37
95 0.38
96 0.34
97 0.35
98 0.31
99 0.27
100 0.27
101 0.24
102 0.24
103 0.2