Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4Q1BHT6

Protein Details
Accession A0A4Q1BHT6    Localization Confidence Medium Confidence Score 12.1
NoLS Segment(s)
PositionSequenceProtein Nature
18-40DIKPPTPSPKKAKKSPRKSVMEGHydrophilic
NLS Segment(s)
PositionSequence
24-36PSPKKAKKSPRKS
Subcellular Location(s) nucl 15, cyto_nucl 13.5, cyto 8
Family & Domain DBs
Amino Acid Sequences MAPVTPVKREASNSSELDIKPPTPSPKKAKKSPRKSVMEGDKKMGAWSGEELKMLYEIMCPKKMGWTRMQDKIKKAIEDMGE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.33
2 0.36
3 0.33
4 0.32
5 0.29
6 0.24
7 0.21
8 0.24
9 0.31
10 0.32
11 0.4
12 0.47
13 0.56
14 0.63
15 0.7
16 0.77
17 0.8
18 0.84
19 0.87
20 0.87
21 0.83
22 0.79
23 0.78
24 0.77
25 0.76
26 0.66
27 0.57
28 0.49
29 0.42
30 0.38
31 0.3
32 0.19
33 0.11
34 0.11
35 0.13
36 0.12
37 0.12
38 0.12
39 0.11
40 0.11
41 0.11
42 0.09
43 0.08
44 0.13
45 0.17
46 0.19
47 0.19
48 0.19
49 0.28
50 0.33
51 0.35
52 0.37
53 0.43
54 0.48
55 0.57
56 0.67
57 0.64
58 0.64
59 0.69
60 0.67
61 0.59
62 0.54