Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Q1BGA3

Protein Details
Accession A0A4Q1BGA3    Localization Confidence Medium Confidence Score 13.2
NoLS Segment(s)
PositionSequenceProtein Nature
30-61SPPITPKKTKVDPKSPKSKTPKTPRTPKAKIEHydrophilic
NLS Segment(s)
PositionSequence
35-63PKKTKVDPKSPKSKTPKTPRTPKAKIEKG
Subcellular Location(s) nucl 21, cyto_nucl 14, cyto 5
Family & Domain DBs
Amino Acid Sequences MPSKRSHSVTSEDMEGENEEEEFKPSISPSPPITPKKTKVDPKSPKSKTPKTPRTPKAKIEKGENGEKGANGVWTSEKKGEFMDEIIAVGYKNADLDSLATKLGMNKRQLIDQLVPNRSNLRGRAVKAISVD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.23
3 0.18
4 0.14
5 0.11
6 0.1
7 0.1
8 0.12
9 0.12
10 0.11
11 0.11
12 0.11
13 0.15
14 0.16
15 0.19
16 0.2
17 0.27
18 0.35
19 0.41
20 0.48
21 0.51
22 0.56
23 0.61
24 0.67
25 0.68
26 0.69
27 0.74
28 0.77
29 0.77
30 0.82
31 0.77
32 0.78
33 0.78
34 0.78
35 0.77
36 0.78
37 0.8
38 0.79
39 0.86
40 0.85
41 0.85
42 0.82
43 0.8
44 0.79
45 0.76
46 0.69
47 0.65
48 0.63
49 0.57
50 0.58
51 0.5
52 0.42
53 0.35
54 0.31
55 0.25
56 0.18
57 0.14
58 0.08
59 0.08
60 0.08
61 0.09
62 0.11
63 0.14
64 0.14
65 0.14
66 0.14
67 0.15
68 0.13
69 0.13
70 0.12
71 0.09
72 0.09
73 0.08
74 0.08
75 0.06
76 0.06
77 0.05
78 0.04
79 0.04
80 0.04
81 0.04
82 0.04
83 0.05
84 0.08
85 0.08
86 0.08
87 0.08
88 0.09
89 0.14
90 0.21
91 0.25
92 0.26
93 0.31
94 0.33
95 0.36
96 0.38
97 0.38
98 0.35
99 0.37
100 0.42
101 0.43
102 0.42
103 0.41
104 0.42
105 0.41
106 0.42
107 0.36
108 0.37
109 0.37
110 0.39
111 0.46
112 0.46