Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

D5GM87

Protein Details
Accession D5GM87    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
7-28IIMKSPSSPKPKPRSGRPTEGTHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 16, extr 7, cyto 2
Family & Domain DBs
KEGG tml:GSTUM_00010570001  -  
Amino Acid Sequences MVLYTTIIMKSPSSPKPKPRSGRPTEGTLLLPPTTTLILFIVGSCQVRYWLRLRFAPSCKVQNACLDTGRGYILLRVLNGNHLLSGGATTHGKGGTAPVCKATKHDFNRQRTTPR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.44
2 0.54
3 0.62
4 0.71
5 0.75
6 0.79
7 0.82
8 0.81
9 0.84
10 0.77
11 0.74
12 0.66
13 0.6
14 0.5
15 0.41
16 0.35
17 0.25
18 0.21
19 0.14
20 0.13
21 0.11
22 0.09
23 0.08
24 0.06
25 0.07
26 0.07
27 0.06
28 0.06
29 0.07
30 0.08
31 0.07
32 0.07
33 0.09
34 0.09
35 0.12
36 0.15
37 0.18
38 0.2
39 0.23
40 0.27
41 0.31
42 0.34
43 0.36
44 0.36
45 0.35
46 0.34
47 0.33
48 0.3
49 0.29
50 0.28
51 0.25
52 0.22
53 0.19
54 0.18
55 0.17
56 0.16
57 0.11
58 0.09
59 0.08
60 0.09
61 0.08
62 0.08
63 0.09
64 0.09
65 0.11
66 0.12
67 0.11
68 0.09
69 0.09
70 0.09
71 0.08
72 0.08
73 0.06
74 0.07
75 0.07
76 0.07
77 0.09
78 0.09
79 0.09
80 0.08
81 0.12
82 0.16
83 0.19
84 0.19
85 0.24
86 0.25
87 0.26
88 0.31
89 0.34
90 0.39
91 0.42
92 0.53
93 0.56
94 0.64
95 0.73