Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Q1BHC0

Protein Details
Accession A0A4Q1BHC0    Localization Confidence Medium Confidence Score 10.8
NoLS Segment(s)
PositionSequenceProtein Nature
190-211AEKSRIEEEKKRKRAEKFGTGQBasic
NLS Segment(s)
PositionSequence
198-204EKKRKRA
Subcellular Location(s) nucl 13.5, mito_nucl 11.666, cyto_nucl 9.833, mito 8.5, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR003034  SAP_dom  
IPR036361  SAP_dom_sf  
Pfam View protein in Pfam  
PF02037  SAP  
PROSITE View protein in PROSITE  
PS50800  SAP  
Amino Acid Sequences MEAKLQKLKVAELKELLAKHHLVQTGKKDDLVKRLLDNGINVDDDGNEITSEDPAPDTTSTAAPTDLGLPTSAPVTDSTSALTQPPADATDLTPEQIQMKARAERFGIPFNPHPTSTPRTSKTEKPTATSTTSTAPAATKEKTTKIDATPKSLGISDEVLAKRAAKFGTVKKHEEPSKQEKTVEISPELAEKSRIEEEKKRKRAEKFGTGQNTTPSNGANEPVRLFFPPFKS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.36
2 0.36
3 0.32
4 0.3
5 0.27
6 0.25
7 0.27
8 0.29
9 0.28
10 0.33
11 0.39
12 0.43
13 0.42
14 0.43
15 0.45
16 0.44
17 0.49
18 0.47
19 0.41
20 0.36
21 0.39
22 0.38
23 0.34
24 0.31
25 0.26
26 0.24
27 0.21
28 0.19
29 0.15
30 0.12
31 0.12
32 0.11
33 0.08
34 0.06
35 0.06
36 0.07
37 0.07
38 0.07
39 0.07
40 0.07
41 0.07
42 0.09
43 0.09
44 0.1
45 0.1
46 0.11
47 0.12
48 0.12
49 0.11
50 0.09
51 0.09
52 0.1
53 0.09
54 0.09
55 0.08
56 0.07
57 0.07
58 0.08
59 0.07
60 0.06
61 0.07
62 0.1
63 0.1
64 0.11
65 0.11
66 0.12
67 0.12
68 0.12
69 0.12
70 0.08
71 0.07
72 0.08
73 0.08
74 0.08
75 0.08
76 0.07
77 0.11
78 0.11
79 0.12
80 0.11
81 0.11
82 0.11
83 0.12
84 0.13
85 0.12
86 0.16
87 0.2
88 0.2
89 0.22
90 0.22
91 0.24
92 0.25
93 0.26
94 0.24
95 0.23
96 0.25
97 0.28
98 0.29
99 0.25
100 0.25
101 0.25
102 0.28
103 0.3
104 0.33
105 0.32
106 0.36
107 0.39
108 0.45
109 0.47
110 0.52
111 0.48
112 0.45
113 0.45
114 0.43
115 0.42
116 0.36
117 0.3
118 0.23
119 0.24
120 0.2
121 0.17
122 0.14
123 0.13
124 0.15
125 0.14
126 0.16
127 0.17
128 0.21
129 0.23
130 0.26
131 0.27
132 0.29
133 0.38
134 0.35
135 0.39
136 0.38
137 0.35
138 0.33
139 0.3
140 0.26
141 0.18
142 0.17
143 0.12
144 0.16
145 0.15
146 0.16
147 0.15
148 0.16
149 0.15
150 0.16
151 0.16
152 0.13
153 0.18
154 0.23
155 0.33
156 0.38
157 0.42
158 0.43
159 0.52
160 0.55
161 0.57
162 0.59
163 0.58
164 0.62
165 0.59
166 0.56
167 0.5
168 0.5
169 0.48
170 0.44
171 0.35
172 0.28
173 0.26
174 0.28
175 0.27
176 0.22
177 0.19
178 0.15
179 0.18
180 0.23
181 0.26
182 0.29
183 0.38
184 0.48
185 0.57
186 0.66
187 0.7
188 0.72
189 0.76
190 0.81
191 0.81
192 0.81
193 0.77
194 0.77
195 0.77
196 0.73
197 0.67
198 0.61
199 0.54
200 0.45
201 0.39
202 0.3
203 0.24
204 0.22
205 0.23
206 0.22
207 0.23
208 0.23
209 0.24
210 0.25
211 0.24
212 0.27