Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4Q1BH41

Protein Details
Accession A0A4Q1BH41    Localization Confidence Medium Confidence Score 10.3
NoLS Segment(s)
PositionSequenceProtein Nature
45-66IWFGIYKWRKRRGNKKAKVLAGHydrophilic
NLS Segment(s)
PositionSequence
52-64WRKRRGNKKAKVL
Subcellular Location(s) cyto 13.5, cyto_nucl 11.5, nucl 8.5, mito 3
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MDDTLRRREDNGGDDGESVSDEAVNLVQQHAYIGATCGIVALGLIWFGIYKWRKRRGNKKAKVLAGEKAQEEVRNLEHKRRLDFEVRKQRADLLRNLMMGPEGTEGKIPT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.28
3 0.22
4 0.18
5 0.13
6 0.09
7 0.06
8 0.05
9 0.05
10 0.05
11 0.05
12 0.05
13 0.06
14 0.06
15 0.06
16 0.06
17 0.06
18 0.06
19 0.05
20 0.06
21 0.06
22 0.06
23 0.06
24 0.05
25 0.05
26 0.04
27 0.04
28 0.03
29 0.02
30 0.02
31 0.02
32 0.02
33 0.02
34 0.02
35 0.1
36 0.13
37 0.19
38 0.28
39 0.38
40 0.45
41 0.55
42 0.66
43 0.7
44 0.79
45 0.81
46 0.83
47 0.81
48 0.77
49 0.74
50 0.65
51 0.58
52 0.51
53 0.45
54 0.35
55 0.29
56 0.27
57 0.22
58 0.21
59 0.18
60 0.17
61 0.22
62 0.23
63 0.29
64 0.34
65 0.37
66 0.39
67 0.41
68 0.43
69 0.45
70 0.51
71 0.55
72 0.6
73 0.61
74 0.6
75 0.56
76 0.59
77 0.56
78 0.53
79 0.48
80 0.44
81 0.43
82 0.42
83 0.42
84 0.35
85 0.28
86 0.24
87 0.19
88 0.14
89 0.12
90 0.11