Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4Q1BRU1

Protein Details
Accession A0A4Q1BRU1    Localization Confidence High Confidence Score 16.3
NoLS Segment(s)
PositionSequenceProtein Nature
83-104PLDLRHKKTRAIRRQLSKKEASHydrophilic
107-126TERQHKRQIHFPQRKYALKAHydrophilic
NLS Segment(s)
PositionSequence
86-102LRHKKTRAIRRQLSKKE
Subcellular Location(s) nucl 23, cyto_nucl 13.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001854  Ribosomal_L29/L35  
IPR036049  Ribosomal_L29/L35_sf  
IPR018254  Ribosomal_L29_CS  
IPR045059  RL35  
Gene Ontology GO:0022625  C:cytosolic large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0000463  P:maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00831  Ribosomal_L29  
PROSITE View protein in PROSITE  
PS00579  RIBOSOMAL_L29  
CDD cd00427  Ribosomal_L29_HIP  
Amino Acid Sequences MSSSSKIKAFELQSKSKADLLTQLTELKTELARLRVQQISGGGANKLTKIGVTRKSIARVLTVINQKQRQNLREFHKKSKYLPLDLRHKKTRAIRRQLSKKEASAVTERQHKRQIHFPQRKYALKA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.5
2 0.51
3 0.47
4 0.42
5 0.34
6 0.33
7 0.3
8 0.28
9 0.27
10 0.27
11 0.24
12 0.24
13 0.23
14 0.18
15 0.14
16 0.14
17 0.15
18 0.16
19 0.17
20 0.18
21 0.23
22 0.24
23 0.23
24 0.22
25 0.2
26 0.19
27 0.19
28 0.18
29 0.13
30 0.13
31 0.13
32 0.11
33 0.11
34 0.08
35 0.07
36 0.1
37 0.15
38 0.2
39 0.23
40 0.27
41 0.28
42 0.31
43 0.33
44 0.3
45 0.26
46 0.21
47 0.18
48 0.21
49 0.24
50 0.24
51 0.28
52 0.32
53 0.32
54 0.37
55 0.41
56 0.4
57 0.39
58 0.44
59 0.46
60 0.52
61 0.56
62 0.59
63 0.63
64 0.61
65 0.59
66 0.63
67 0.6
68 0.56
69 0.58
70 0.56
71 0.59
72 0.65
73 0.69
74 0.66
75 0.63
76 0.63
77 0.65
78 0.68
79 0.68
80 0.7
81 0.71
82 0.75
83 0.84
84 0.86
85 0.85
86 0.79
87 0.71
88 0.67
89 0.59
90 0.53
91 0.48
92 0.45
93 0.42
94 0.48
95 0.49
96 0.48
97 0.55
98 0.56
99 0.54
100 0.59
101 0.64
102 0.65
103 0.73
104 0.71
105 0.74
106 0.78