Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4Q1BIY3

Protein Details
Accession A0A4Q1BIY3    Localization Confidence Low Confidence Score 9.1
NoLS Segment(s)
PositionSequenceProtein Nature
178-212YLPRRERELRSRERARARRRERRRTMREEERRSYGBasic
NLS Segment(s)
PositionSequence
180-204PRRERELRSRERARARRRERRRTMR
Subcellular Location(s) mito 16.5, cyto_mito 11.5, cyto 5.5, nucl 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR028018  DUF4646  
Pfam View protein in Pfam  
PF15496  DUF4646  
Amino Acid Sequences MRRVSRIVFTWRVGPPCFDRPPAQADSYYRYDPFEAFSLPAQKLNRAWELHTPRQLVSHDVSEEDWTRFITDLSQEALHSAQHDWAGRNRNALGRGPQPVLTDGVHSLLASWAVAFFAPRGIRVYAAQNGQRVIPPPIEPLSSRGISRASDYSSATSDEEESESGWGEENEAKRRDMYLPRRERELRSRERARARRRERRRTMREEERRSYGEGDWEVHFVHMTPTIWQAGARPRTYGEPVLRRRR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.43
2 0.41
3 0.45
4 0.47
5 0.44
6 0.43
7 0.42
8 0.46
9 0.46
10 0.42
11 0.38
12 0.37
13 0.39
14 0.4
15 0.4
16 0.34
17 0.31
18 0.3
19 0.27
20 0.26
21 0.22
22 0.18
23 0.17
24 0.19
25 0.23
26 0.22
27 0.27
28 0.25
29 0.26
30 0.28
31 0.31
32 0.34
33 0.3
34 0.32
35 0.37
36 0.44
37 0.48
38 0.51
39 0.48
40 0.42
41 0.45
42 0.43
43 0.37
44 0.31
45 0.27
46 0.21
47 0.2
48 0.21
49 0.2
50 0.21
51 0.18
52 0.16
53 0.13
54 0.13
55 0.12
56 0.12
57 0.1
58 0.1
59 0.1
60 0.12
61 0.12
62 0.11
63 0.11
64 0.12
65 0.1
66 0.1
67 0.09
68 0.09
69 0.1
70 0.12
71 0.13
72 0.18
73 0.25
74 0.24
75 0.26
76 0.26
77 0.27
78 0.28
79 0.29
80 0.28
81 0.24
82 0.27
83 0.25
84 0.26
85 0.23
86 0.22
87 0.21
88 0.17
89 0.15
90 0.12
91 0.11
92 0.1
93 0.09
94 0.08
95 0.06
96 0.06
97 0.05
98 0.04
99 0.03
100 0.03
101 0.03
102 0.03
103 0.03
104 0.06
105 0.06
106 0.07
107 0.09
108 0.09
109 0.1
110 0.11
111 0.14
112 0.14
113 0.17
114 0.18
115 0.17
116 0.18
117 0.17
118 0.17
119 0.16
120 0.15
121 0.13
122 0.12
123 0.13
124 0.14
125 0.14
126 0.14
127 0.15
128 0.17
129 0.17
130 0.16
131 0.15
132 0.16
133 0.15
134 0.17
135 0.16
136 0.13
137 0.14
138 0.15
139 0.15
140 0.15
141 0.16
142 0.14
143 0.12
144 0.11
145 0.1
146 0.1
147 0.09
148 0.08
149 0.07
150 0.07
151 0.07
152 0.07
153 0.06
154 0.07
155 0.1
156 0.14
157 0.2
158 0.21
159 0.22
160 0.22
161 0.24
162 0.28
163 0.34
164 0.41
165 0.45
166 0.53
167 0.54
168 0.62
169 0.64
170 0.64
171 0.65
172 0.65
173 0.64
174 0.65
175 0.7
176 0.71
177 0.78
178 0.81
179 0.82
180 0.83
181 0.84
182 0.85
183 0.88
184 0.91
185 0.92
186 0.93
187 0.93
188 0.91
189 0.9
190 0.91
191 0.91
192 0.89
193 0.83
194 0.79
195 0.71
196 0.64
197 0.57
198 0.47
199 0.42
200 0.35
201 0.31
202 0.26
203 0.25
204 0.23
205 0.2
206 0.19
207 0.13
208 0.12
209 0.13
210 0.13
211 0.13
212 0.15
213 0.16
214 0.16
215 0.16
216 0.19
217 0.25
218 0.32
219 0.31
220 0.3
221 0.31
222 0.36
223 0.4
224 0.43
225 0.43
226 0.46