Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4Q1BU24

Protein Details
Accession A0A4Q1BU24    Localization Confidence High Confidence Score 15.2
NoLS Segment(s)
PositionSequenceProtein Nature
22-54RLPATFAPKNKRKANKKESKKQRLRREEGKDKABasic
60-83KLQVKVKDREEKKSKRERAKKAWEBasic
NLS Segment(s)
PositionSequence
28-82APKNKRKANKKESKKQRLRREEGKDKAQERNMKLQVKVKDREEKKSKRERAKKAW
Subcellular Location(s) nucl 20, cyto_nucl 12.5, mito 3, cyto 3
Family & Domain DBs
Amino Acid Sequences MPGDNAQTSSTAGPSKLANNPRLPATFAPKNKRKANKKESKKQRLRREEGKDKAQERNMKLQVKVKDREEKKSKRERAKKAWE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.18
3 0.24
4 0.3
5 0.33
6 0.35
7 0.37
8 0.39
9 0.38
10 0.38
11 0.33
12 0.34
13 0.36
14 0.4
15 0.48
16 0.51
17 0.58
18 0.63
19 0.71
20 0.73
21 0.76
22 0.8
23 0.81
24 0.84
25 0.87
26 0.9
27 0.91
28 0.92
29 0.9
30 0.9
31 0.9
32 0.87
33 0.86
34 0.84
35 0.83
36 0.79
37 0.78
38 0.74
39 0.67
40 0.66
41 0.63
42 0.61
43 0.54
44 0.58
45 0.57
46 0.54
47 0.54
48 0.55
49 0.56
50 0.56
51 0.59
52 0.56
53 0.58
54 0.58
55 0.65
56 0.69
57 0.71
58 0.73
59 0.78
60 0.81
61 0.83
62 0.89
63 0.89