Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Q1BP77

Protein Details
Accession A0A4Q1BP77    Localization Confidence Low Confidence Score 9.5
NoLS Segment(s)
PositionSequenceProtein Nature
15-40AEPPSPSRERGKCKCCKQKPYGSYGTHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 16.5, cyto_nucl 11, mito 5, cyto 4.5
Family & Domain DBs
Amino Acid Sequences MTKPSPSTLRSHPTAEPPSPSRERGKCKCCKQKPYGSYGTVPYGGRVGLVLGALWEISDSREQTSPPDSPSKTTPKVEYPTSPDPRRNRMEVTQPPMEMTNLTSPQRAKVAVHPTNGYACR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.52
2 0.49
3 0.47
4 0.43
5 0.48
6 0.48
7 0.49
8 0.49
9 0.51
10 0.58
11 0.62
12 0.69
13 0.71
14 0.77
15 0.84
16 0.85
17 0.87
18 0.86
19 0.86
20 0.82
21 0.8
22 0.76
23 0.68
24 0.61
25 0.53
26 0.46
27 0.38
28 0.33
29 0.25
30 0.18
31 0.15
32 0.12
33 0.09
34 0.07
35 0.04
36 0.04
37 0.04
38 0.03
39 0.03
40 0.03
41 0.03
42 0.03
43 0.02
44 0.03
45 0.05
46 0.06
47 0.07
48 0.08
49 0.08
50 0.1
51 0.14
52 0.14
53 0.15
54 0.21
55 0.2
56 0.22
57 0.27
58 0.33
59 0.34
60 0.35
61 0.36
62 0.36
63 0.4
64 0.4
65 0.38
66 0.38
67 0.43
68 0.49
69 0.51
70 0.52
71 0.54
72 0.59
73 0.61
74 0.57
75 0.53
76 0.49
77 0.55
78 0.55
79 0.56
80 0.52
81 0.47
82 0.44
83 0.4
84 0.36
85 0.26
86 0.21
87 0.21
88 0.22
89 0.23
90 0.25
91 0.25
92 0.28
93 0.3
94 0.29
95 0.25
96 0.28
97 0.37
98 0.39
99 0.43
100 0.41
101 0.41