Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4Q1BDD6

Protein Details
Accession A0A4Q1BDD6    Localization Confidence Medium Confidence Score 12.1
NoLS Segment(s)
PositionSequenceProtein Nature
12-45GKVRSQCPKVEKQEKRKKRCGRAHKREQYVRRFLBasic
NLS Segment(s)
PositionSequence
22-37EKQEKRKKRCGRAHKR
Subcellular Location(s) nucl 11, mito 10, cyto 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR006846  Ribosomal_S30  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF04758  Ribosomal_S30  
Amino Acid Sequences MGKVHGSLARAGKVRSQCPKVEKQEKRKKRCGRAHKREQYVRRFLVVSVAPGGKRKVNPQPAGKSG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.4
2 0.44
3 0.45
4 0.46
5 0.5
6 0.59
7 0.63
8 0.68
9 0.7
10 0.73
11 0.79
12 0.84
13 0.87
14 0.88
15 0.87
16 0.87
17 0.88
18 0.88
19 0.89
20 0.89
21 0.91
22 0.9
23 0.89
24 0.87
25 0.85
26 0.82
27 0.79
28 0.69
29 0.6
30 0.52
31 0.43
32 0.39
33 0.32
34 0.24
35 0.19
36 0.2
37 0.19
38 0.21
39 0.23
40 0.23
41 0.25
42 0.31
43 0.38
44 0.47
45 0.54
46 0.6