Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4Q1BFQ7

Protein Details
Accession A0A4Q1BFQ7    Localization Confidence Medium Confidence Score 10.2
NoLS Segment(s)
PositionSequenceProtein Nature
17-42AAGGKAGKKKKWSKGKVKDKANNAVVHydrophilic
NLS Segment(s)
PositionSequence
9-36KAQKAAAAAAGGKAGKKKKWSKGKVKDK
Subcellular Location(s) mito 11, cyto 10, nucl 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR004977  Ribosomal_S25  
IPR036390  WH_DNA-bd_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF03297  Ribosomal_S25  
Amino Acid Sequences MPPAQVKSKAQKAAAAAAGGKAGKKKKWSKGKVKDKANNAVVLDKPLFDRIVKEVPTYRVITVSTLIDRMKVNGSLARRAIAYLEEEGLIKPVVVHRAQVVYTRAIVKD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.42
2 0.34
3 0.26
4 0.2
5 0.21
6 0.18
7 0.17
8 0.18
9 0.21
10 0.24
11 0.33
12 0.42
13 0.5
14 0.61
15 0.7
16 0.75
17 0.81
18 0.89
19 0.88
20 0.9
21 0.87
22 0.83
23 0.82
24 0.73
25 0.65
26 0.54
27 0.48
28 0.37
29 0.33
30 0.26
31 0.17
32 0.15
33 0.13
34 0.13
35 0.1
36 0.11
37 0.12
38 0.16
39 0.16
40 0.17
41 0.18
42 0.19
43 0.22
44 0.22
45 0.19
46 0.16
47 0.16
48 0.15
49 0.14
50 0.12
51 0.1
52 0.11
53 0.1
54 0.11
55 0.11
56 0.12
57 0.12
58 0.12
59 0.13
60 0.14
61 0.16
62 0.19
63 0.19
64 0.19
65 0.17
66 0.17
67 0.16
68 0.14
69 0.14
70 0.1
71 0.11
72 0.1
73 0.1
74 0.1
75 0.11
76 0.1
77 0.08
78 0.07
79 0.09
80 0.14
81 0.14
82 0.15
83 0.16
84 0.19
85 0.2
86 0.24
87 0.24
88 0.21
89 0.24