Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Q1BU19

Protein Details
Accession A0A4Q1BU19   
Localization Confidence Medium
Confidence Score 12.1
NoLS Segment(s)
PositionSequenceProtein Nature
208-237LEPPKPEPKPKAKAKPKAEPKPRTKKPSAABasic
NLS Segment(s)
PositionSequence
192-245PTRPKTGGKTFKLAQLLEPPKPEPKPKAKAKPKAEPKPRTKKPSAAVPKKPPTP
Subcellular Location(s) nucl 15, cyto_nucl 10.5, mito 7, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR027093  EAF_fam  
IPR019194  Tscrpt_elong_fac_Eaf_N  
Gene Ontology GO:0032783  C:super elongation complex  
GO:0006355  P:regulation of DNA-templated transcription  
Pfam View protein in Pfam  
PF09816  EAF  
Amino Acid Sequences MAATPLAGFPYSGSFSIQLAGSLNPLKRSREEDELVSLRYPFKPSSIQPKTQGNLEYTPQGRRGVLRPRNAPQQVFDVREEENKARECVLIYDPATNGFTLHALPTTLHMTLNRSPSTNSLQLALPPVRRPSDASTSSSTSVPLAQGWPANRGERNSNSSQEKYEVSSMVGPDTPALPAAKRPRVSEPAPTPTRPKTGGKTFKLAQLLEPPKPEPKPKAKAKPKAEPKPRTKKPSAAVPKKPPTPIKVKSVEVIEDSDEEFEEVGADDGDDEFARLVEQSLAQGADEEDEEEESSEEEEEDDGLGGARLVIRHADYNHGRSEWI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.15
3 0.17
4 0.16
5 0.13
6 0.12
7 0.12
8 0.14
9 0.18
10 0.2
11 0.25
12 0.28
13 0.31
14 0.33
15 0.4
16 0.41
17 0.44
18 0.45
19 0.41
20 0.46
21 0.45
22 0.43
23 0.38
24 0.34
25 0.28
26 0.28
27 0.29
28 0.21
29 0.22
30 0.26
31 0.3
32 0.4
33 0.45
34 0.49
35 0.51
36 0.58
37 0.57
38 0.56
39 0.54
40 0.46
41 0.42
42 0.38
43 0.39
44 0.33
45 0.35
46 0.33
47 0.31
48 0.29
49 0.29
50 0.34
51 0.38
52 0.43
53 0.48
54 0.51
55 0.55
56 0.64
57 0.66
58 0.6
59 0.52
60 0.52
61 0.49
62 0.46
63 0.41
64 0.33
65 0.3
66 0.32
67 0.34
68 0.28
69 0.28
70 0.27
71 0.27
72 0.25
73 0.25
74 0.22
75 0.2
76 0.2
77 0.19
78 0.18
79 0.19
80 0.18
81 0.19
82 0.19
83 0.15
84 0.14
85 0.09
86 0.09
87 0.08
88 0.08
89 0.07
90 0.06
91 0.07
92 0.08
93 0.1
94 0.1
95 0.1
96 0.11
97 0.15
98 0.19
99 0.24
100 0.22
101 0.21
102 0.22
103 0.24
104 0.29
105 0.27
106 0.23
107 0.2
108 0.19
109 0.19
110 0.23
111 0.23
112 0.19
113 0.19
114 0.21
115 0.21
116 0.21
117 0.23
118 0.24
119 0.29
120 0.29
121 0.3
122 0.31
123 0.31
124 0.32
125 0.29
126 0.25
127 0.17
128 0.15
129 0.12
130 0.09
131 0.08
132 0.07
133 0.09
134 0.1
135 0.12
136 0.13
137 0.15
138 0.16
139 0.17
140 0.21
141 0.22
142 0.27
143 0.27
144 0.3
145 0.32
146 0.31
147 0.31
148 0.28
149 0.25
150 0.21
151 0.2
152 0.15
153 0.12
154 0.12
155 0.11
156 0.1
157 0.1
158 0.08
159 0.07
160 0.07
161 0.06
162 0.06
163 0.06
164 0.06
165 0.11
166 0.18
167 0.24
168 0.25
169 0.27
170 0.32
171 0.37
172 0.39
173 0.41
174 0.4
175 0.43
176 0.45
177 0.44
178 0.43
179 0.41
180 0.43
181 0.39
182 0.37
183 0.35
184 0.42
185 0.5
186 0.48
187 0.51
188 0.49
189 0.49
190 0.49
191 0.43
192 0.34
193 0.34
194 0.36
195 0.32
196 0.33
197 0.3
198 0.32
199 0.35
200 0.39
201 0.37
202 0.43
203 0.5
204 0.58
205 0.67
206 0.72
207 0.79
208 0.82
209 0.84
210 0.86
211 0.87
212 0.87
213 0.87
214 0.87
215 0.88
216 0.89
217 0.88
218 0.83
219 0.8
220 0.74
221 0.75
222 0.75
223 0.74
224 0.75
225 0.76
226 0.78
227 0.76
228 0.78
229 0.72
230 0.66
231 0.66
232 0.62
233 0.6
234 0.57
235 0.54
236 0.5
237 0.47
238 0.43
239 0.35
240 0.31
241 0.23
242 0.19
243 0.17
244 0.14
245 0.12
246 0.11
247 0.09
248 0.07
249 0.06
250 0.05
251 0.05
252 0.05
253 0.05
254 0.05
255 0.05
256 0.06
257 0.05
258 0.05
259 0.05
260 0.05
261 0.06
262 0.06
263 0.06
264 0.07
265 0.07
266 0.07
267 0.09
268 0.09
269 0.09
270 0.09
271 0.08
272 0.08
273 0.08
274 0.08
275 0.07
276 0.08
277 0.09
278 0.09
279 0.09
280 0.08
281 0.08
282 0.08
283 0.08
284 0.07
285 0.07
286 0.07
287 0.07
288 0.07
289 0.06
290 0.06
291 0.06
292 0.05
293 0.06
294 0.07
295 0.06
296 0.07
297 0.1
298 0.11
299 0.16
300 0.17
301 0.26
302 0.31
303 0.35
304 0.38