Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Q1BEB7

Protein Details
Accession A0A4Q1BEB7   
Localization Confidence Medium
Confidence Score 12.8
NoLS Segment(s)
PositionSequenceProtein Nature
26-51AKSKNHTNHNQNKKAHKNKIKRAVTSHydrophilic
NLS Segment(s)
PositionSequence
38-55KKAHKNKIKRAVTSRHPN
Subcellular Location(s) nucl 16.5, mito 9, cyto_nucl 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR002673  Ribosomal_L29e  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01779  Ribosomal_L29e  
Amino Acid Sequences MTASSRFTKLEHRYHLLFYNTEFTMAKSKNHTNHNQNKKAHKNKIKRAVTSRHPNQKGVDAKFRRNQKYAVQGSLRAVREARKAAAGTA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.51
2 0.55
3 0.48
4 0.4
5 0.33
6 0.31
7 0.25
8 0.24
9 0.21
10 0.17
11 0.23
12 0.23
13 0.24
14 0.25
15 0.31
16 0.36
17 0.43
18 0.5
19 0.52
20 0.61
21 0.7
22 0.72
23 0.72
24 0.75
25 0.78
26 0.8
27 0.8
28 0.79
29 0.79
30 0.8
31 0.84
32 0.8
33 0.75
34 0.72
35 0.69
36 0.68
37 0.69
38 0.68
39 0.68
40 0.65
41 0.63
42 0.57
43 0.58
44 0.56
45 0.5
46 0.52
47 0.46
48 0.51
49 0.55
50 0.63
51 0.61
52 0.56
53 0.56
54 0.52
55 0.58
56 0.55
57 0.56
58 0.49
59 0.45
60 0.47
61 0.5
62 0.44
63 0.36
64 0.33
65 0.31
66 0.35
67 0.36
68 0.33
69 0.31