Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4V1M4N7

Protein Details
Accession A0A4V1M4N7    Localization Confidence High Confidence Score 16.8
NoLS Segment(s)
PositionSequenceProtein Nature
2-27AKSLRAKTKMAGRRKKRNDSHYAVVEHydrophilic
NLS Segment(s)
PositionSequence
6-18RAKTKMAGRRKKR
73-116PRMSRRESWRLSKGMSARPKNQGGQNKAGYKHAAKGAGKPGRRR
Subcellular Location(s) nucl 17, mito 8
Family & Domain DBs
InterPro View protein in InterPro  
IPR019434  DUF2423  
Pfam View protein in Pfam  
PF10338  DUF2423  
Amino Acid Sequences MAKSLRAKTKMAGRRKKRNDSHYAVVEAARTARVSEKLLGKSQNSEEEVPAAEEEITDEKMEEEPKKISTAGPRMSRRESWRLSKGMSARPKNQGGQNKAGYKHAAKGAGKPGRRR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.75
2 0.84
3 0.89
4 0.88
5 0.89
6 0.88
7 0.85
8 0.82
9 0.75
10 0.67
11 0.57
12 0.48
13 0.39
14 0.3
15 0.22
16 0.15
17 0.11
18 0.09
19 0.11
20 0.12
21 0.14
22 0.18
23 0.23
24 0.25
25 0.28
26 0.31
27 0.29
28 0.3
29 0.3
30 0.3
31 0.27
32 0.25
33 0.22
34 0.19
35 0.19
36 0.16
37 0.13
38 0.09
39 0.06
40 0.05
41 0.06
42 0.06
43 0.06
44 0.06
45 0.06
46 0.06
47 0.07
48 0.1
49 0.1
50 0.11
51 0.12
52 0.13
53 0.14
54 0.14
55 0.15
56 0.19
57 0.25
58 0.29
59 0.36
60 0.4
61 0.44
62 0.48
63 0.51
64 0.51
65 0.53
66 0.52
67 0.51
68 0.53
69 0.51
70 0.48
71 0.48
72 0.47
73 0.47
74 0.52
75 0.5
76 0.5
77 0.55
78 0.58
79 0.58
80 0.6
81 0.61
82 0.57
83 0.59
84 0.61
85 0.59
86 0.56
87 0.55
88 0.52
89 0.45
90 0.44
91 0.41
92 0.41
93 0.36
94 0.41
95 0.48
96 0.51