Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Q1BKE0

Protein Details
Accession A0A4Q1BKE0    Localization Confidence Medium Confidence Score 12.8
NoLS Segment(s)
PositionSequenceProtein Nature
252-314QNNGEGEEKKKKKKRPVPDGEEEKKVSKKKKKVIQPVEEKIKVEEKGESKPKKKKPKKKDVEQBasic
NLS Segment(s)
PositionSequence
259-310EKKKKKKRPVPDGEEEKKVSKKKKKVIQPVEEKIKVEEKGESKPKKKKPKKK
Subcellular Location(s) nucl 17.5, mito_nucl 12.5, mito 6.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR021950  Spt20  
IPR046468  Spt20-like_SEP  
Gene Ontology GO:0000124  C:SAGA complex  
GO:0003712  F:transcription coregulator activity  
Pfam View protein in Pfam  
PF12090  Spt20  
Amino Acid Sequences MASASGYNHHRFARAVLKKSRKWEPSLTVQLYAKNWRFENSPVTFTYDGPMKPFLLALRSQVIPSSLMPFLYDIQPPVSFVDGCLVVEIQDFRKEPEGRSRVVMRPAAETLSYTIDSMLERKGQDWDEKMRLELESRIIAATSPPLYLGTSILASRNATLAMAITTPAGPHLSADGGYRPEVPETDTSNETERMRKLFFAGGKDRDHTAPYQPSWSILSLKERLAEAARQDIGNSVSGSVGNVNNNNGNNGQNNGEGEEKKKKKKRPVPDGEEEKKVSKKKKKVIQPVEEKIKVEEKGESKPKKKKPKKKDVEQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.41
2 0.46
3 0.52
4 0.61
5 0.65
6 0.72
7 0.77
8 0.73
9 0.71
10 0.71
11 0.67
12 0.67
13 0.72
14 0.67
15 0.62
16 0.57
17 0.54
18 0.49
19 0.52
20 0.47
21 0.42
22 0.4
23 0.38
24 0.39
25 0.38
26 0.44
27 0.38
28 0.37
29 0.32
30 0.37
31 0.35
32 0.33
33 0.32
34 0.28
35 0.25
36 0.24
37 0.25
38 0.2
39 0.19
40 0.2
41 0.18
42 0.16
43 0.17
44 0.17
45 0.19
46 0.19
47 0.18
48 0.18
49 0.18
50 0.16
51 0.16
52 0.17
53 0.13
54 0.12
55 0.13
56 0.13
57 0.14
58 0.15
59 0.15
60 0.12
61 0.14
62 0.14
63 0.14
64 0.14
65 0.14
66 0.12
67 0.11
68 0.13
69 0.11
70 0.11
71 0.1
72 0.09
73 0.07
74 0.08
75 0.1
76 0.09
77 0.12
78 0.13
79 0.14
80 0.22
81 0.23
82 0.25
83 0.34
84 0.36
85 0.33
86 0.37
87 0.4
88 0.36
89 0.4
90 0.41
91 0.31
92 0.31
93 0.3
94 0.27
95 0.22
96 0.19
97 0.14
98 0.14
99 0.13
100 0.1
101 0.1
102 0.09
103 0.09
104 0.1
105 0.1
106 0.1
107 0.1
108 0.11
109 0.14
110 0.15
111 0.18
112 0.2
113 0.24
114 0.25
115 0.25
116 0.25
117 0.23
118 0.22
119 0.2
120 0.18
121 0.14
122 0.11
123 0.11
124 0.1
125 0.09
126 0.09
127 0.08
128 0.08
129 0.07
130 0.06
131 0.06
132 0.06
133 0.07
134 0.07
135 0.07
136 0.06
137 0.06
138 0.06
139 0.06
140 0.07
141 0.07
142 0.07
143 0.07
144 0.06
145 0.05
146 0.05
147 0.04
148 0.04
149 0.04
150 0.04
151 0.04
152 0.04
153 0.04
154 0.04
155 0.05
156 0.04
157 0.04
158 0.05
159 0.05
160 0.05
161 0.06
162 0.07
163 0.08
164 0.08
165 0.09
166 0.09
167 0.09
168 0.09
169 0.1
170 0.11
171 0.14
172 0.16
173 0.16
174 0.17
175 0.19
176 0.22
177 0.21
178 0.22
179 0.21
180 0.21
181 0.21
182 0.2
183 0.2
184 0.21
185 0.22
186 0.25
187 0.29
188 0.31
189 0.32
190 0.33
191 0.33
192 0.3
193 0.29
194 0.25
195 0.24
196 0.25
197 0.24
198 0.26
199 0.24
200 0.24
201 0.24
202 0.24
203 0.2
204 0.17
205 0.22
206 0.21
207 0.22
208 0.22
209 0.2
210 0.2
211 0.2
212 0.21
213 0.16
214 0.18
215 0.19
216 0.17
217 0.17
218 0.17
219 0.16
220 0.16
221 0.15
222 0.1
223 0.09
224 0.09
225 0.1
226 0.1
227 0.11
228 0.12
229 0.13
230 0.15
231 0.18
232 0.18
233 0.2
234 0.19
235 0.2
236 0.18
237 0.19
238 0.19
239 0.17
240 0.17
241 0.17
242 0.2
243 0.19
244 0.23
245 0.32
246 0.39
247 0.48
248 0.56
249 0.63
250 0.7
251 0.79
252 0.85
253 0.85
254 0.88
255 0.87
256 0.89
257 0.91
258 0.85
259 0.82
260 0.74
261 0.67
262 0.64
263 0.62
264 0.62
265 0.62
266 0.67
267 0.7
268 0.76
269 0.82
270 0.85
271 0.88
272 0.89
273 0.89
274 0.89
275 0.89
276 0.83
277 0.74
278 0.66
279 0.62
280 0.53
281 0.44
282 0.41
283 0.34
284 0.4
285 0.49
286 0.56
287 0.59
288 0.68
289 0.77
290 0.81
291 0.89
292 0.9
293 0.91
294 0.93