Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4Q1BST1

Protein Details
Accession A0A4Q1BST1    Localization Confidence Medium Confidence Score 13.6
NoLS Segment(s)
PositionSequenceProtein Nature
50-72SGSSRPSGRGRPRQTRPARKTADHydrophilic
NLS Segment(s)
PositionSequence
44-69RNAPRNSGSSRPSGRGRPRQTRPARK
Subcellular Location(s) nucl 21, cyto_nucl 12.5, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR025715  FoP_C  
Gene Ontology GO:0003723  F:RNA binding  
Pfam View protein in Pfam  
PF13865  FoP_duplication  
Amino Acid Sequences MTVDRAQYEYWIHISERPMKVELAFDPSQLQSLASRVAPAPAPRNAPRNSGSSRPSGRGRPRQTRPARKTADELDAEMSAYKENNAA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.31
3 0.32
4 0.32
5 0.31
6 0.3
7 0.29
8 0.28
9 0.25
10 0.23
11 0.2
12 0.18
13 0.18
14 0.18
15 0.18
16 0.16
17 0.15
18 0.08
19 0.09
20 0.1
21 0.08
22 0.09
23 0.08
24 0.09
25 0.1
26 0.12
27 0.14
28 0.15
29 0.2
30 0.22
31 0.28
32 0.29
33 0.31
34 0.31
35 0.32
36 0.33
37 0.33
38 0.33
39 0.34
40 0.35
41 0.36
42 0.38
43 0.41
44 0.48
45 0.53
46 0.6
47 0.63
48 0.68
49 0.74
50 0.81
51 0.84
52 0.82
53 0.82
54 0.79
55 0.72
56 0.7
57 0.64
58 0.6
59 0.5
60 0.45
61 0.37
62 0.31
63 0.28
64 0.23
65 0.19
66 0.13
67 0.12