Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A428QD05

Protein Details
Accession A0A428QD05    Localization Confidence Low Confidence Score 6.1
NoLS Segment(s)
PositionSequenceProtein Nature
76-101AEGVRAKYIRTRRRIRRENCHGGRVPBasic
NLS Segment(s)
Subcellular Location(s) mito 20.5, cyto_mito 11.5, nucl 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR024079  MetalloPept_cat_dom_sf  
IPR001384  Peptidase_M35  
Gene Ontology GO:0004222  F:metalloendopeptidase activity  
GO:0006508  P:proteolysis  
Pfam View protein in Pfam  
PF02102  Peptidase_M35  
CDD cd11008  M35_deuterolysin_like  
Amino Acid Sequences MDYTKLKRGHFTTIPSAKTIKVRFNIAENYDLTAGGEHTIHMVGTLPFGQIRGRHIAGYIPYNSNKLTFTVNGEAAEGVRAKYIRTRRRIRRENCHGGRVPRMRESLSNCVQLSLAAQEAALNGPAWRMEEAFGFSDTPIRQQVANVFSDTAERCRQDSARIHEFCREYYRDCVSGDRILMAYLRETTLQIGYCDKFYDLPVMPKRCYVYDRPDAWGWFPSRASTVIQKTVHATLRKTGMPGNMSLDAEPGLPKILALDRNSSLQSPDNYELFATHLKLGCIAVSPDQETNAMAGIPLFGKT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.56
2 0.51
3 0.49
4 0.44
5 0.47
6 0.46
7 0.44
8 0.4
9 0.44
10 0.43
11 0.48
12 0.51
13 0.45
14 0.44
15 0.37
16 0.36
17 0.3
18 0.28
19 0.22
20 0.16
21 0.14
22 0.11
23 0.1
24 0.07
25 0.08
26 0.08
27 0.07
28 0.07
29 0.08
30 0.07
31 0.09
32 0.09
33 0.09
34 0.09
35 0.1
36 0.12
37 0.12
38 0.16
39 0.21
40 0.21
41 0.21
42 0.21
43 0.23
44 0.24
45 0.27
46 0.26
47 0.24
48 0.25
49 0.26
50 0.26
51 0.24
52 0.23
53 0.19
54 0.19
55 0.16
56 0.19
57 0.21
58 0.21
59 0.2
60 0.2
61 0.18
62 0.15
63 0.16
64 0.12
65 0.08
66 0.09
67 0.09
68 0.09
69 0.16
70 0.26
71 0.33
72 0.42
73 0.53
74 0.62
75 0.73
76 0.83
77 0.85
78 0.86
79 0.88
80 0.89
81 0.83
82 0.81
83 0.74
84 0.67
85 0.68
86 0.63
87 0.56
88 0.5
89 0.47
90 0.41
91 0.41
92 0.43
93 0.41
94 0.39
95 0.4
96 0.35
97 0.33
98 0.31
99 0.27
100 0.21
101 0.14
102 0.1
103 0.06
104 0.05
105 0.05
106 0.05
107 0.06
108 0.05
109 0.04
110 0.04
111 0.04
112 0.05
113 0.05
114 0.05
115 0.06
116 0.06
117 0.06
118 0.08
119 0.09
120 0.09
121 0.09
122 0.08
123 0.12
124 0.11
125 0.12
126 0.12
127 0.12
128 0.11
129 0.11
130 0.16
131 0.14
132 0.15
133 0.14
134 0.13
135 0.12
136 0.14
137 0.14
138 0.13
139 0.13
140 0.13
141 0.13
142 0.15
143 0.16
144 0.2
145 0.26
146 0.3
147 0.36
148 0.37
149 0.38
150 0.41
151 0.41
152 0.36
153 0.35
154 0.3
155 0.24
156 0.26
157 0.27
158 0.24
159 0.24
160 0.24
161 0.21
162 0.21
163 0.19
164 0.15
165 0.13
166 0.11
167 0.11
168 0.1
169 0.08
170 0.07
171 0.07
172 0.07
173 0.07
174 0.08
175 0.09
176 0.09
177 0.09
178 0.12
179 0.12
180 0.12
181 0.13
182 0.12
183 0.11
184 0.11
185 0.16
186 0.14
187 0.22
188 0.29
189 0.32
190 0.33
191 0.34
192 0.36
193 0.33
194 0.36
195 0.33
196 0.34
197 0.39
198 0.4
199 0.42
200 0.43
201 0.41
202 0.39
203 0.38
204 0.32
205 0.25
206 0.24
207 0.2
208 0.19
209 0.2
210 0.2
211 0.22
212 0.25
213 0.3
214 0.3
215 0.3
216 0.31
217 0.34
218 0.38
219 0.35
220 0.32
221 0.29
222 0.33
223 0.33
224 0.32
225 0.3
226 0.28
227 0.27
228 0.26
229 0.26
230 0.25
231 0.24
232 0.23
233 0.2
234 0.16
235 0.15
236 0.14
237 0.1
238 0.09
239 0.08
240 0.07
241 0.09
242 0.13
243 0.17
244 0.19
245 0.23
246 0.24
247 0.27
248 0.28
249 0.27
250 0.25
251 0.25
252 0.25
253 0.27
254 0.29
255 0.27
256 0.26
257 0.25
258 0.23
259 0.22
260 0.22
261 0.17
262 0.18
263 0.19
264 0.19
265 0.2
266 0.2
267 0.17
268 0.16
269 0.16
270 0.16
271 0.17
272 0.2
273 0.19
274 0.2
275 0.2
276 0.19
277 0.17
278 0.14
279 0.11
280 0.08
281 0.07
282 0.08