Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A428NGD9

Protein Details
Accession A0A428NGD9    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
71-92QGYKRRPILRLLSKQRRWRFYLHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 22, plas 3
Family & Domain DBs
Amino Acid Sequences MKVATTLLVSAWLLFSSVLGDGHSLCACQSRSNGPTVDSATQACCSRVGAHSGPPASYRGNQIRRPILSGQGYKRRPILRLLSKQRRWRFYLSILGRIRTDP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.06
3 0.06
4 0.06
5 0.06
6 0.06
7 0.07
8 0.06
9 0.09
10 0.09
11 0.08
12 0.07
13 0.11
14 0.12
15 0.13
16 0.15
17 0.19
18 0.21
19 0.24
20 0.25
21 0.21
22 0.23
23 0.24
24 0.23
25 0.18
26 0.17
27 0.15
28 0.16
29 0.16
30 0.14
31 0.11
32 0.1
33 0.11
34 0.11
35 0.14
36 0.13
37 0.15
38 0.17
39 0.17
40 0.17
41 0.16
42 0.17
43 0.14
44 0.15
45 0.19
46 0.25
47 0.31
48 0.35
49 0.4
50 0.44
51 0.43
52 0.45
53 0.4
54 0.38
55 0.37
56 0.38
57 0.4
58 0.44
59 0.46
60 0.44
61 0.5
62 0.47
63 0.43
64 0.44
65 0.47
66 0.47
67 0.56
68 0.65
69 0.69
70 0.75
71 0.83
72 0.86
73 0.82
74 0.77
75 0.74
76 0.68
77 0.63
78 0.65
79 0.59
80 0.6
81 0.57
82 0.54