Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E2LKV4

Protein Details
Accession E2LKV4    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
59-84KSQIQTRKTEPCQRKKLRVQMFHGTNHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 13, nucl 10, cyto_nucl 7.5, cyto 3
Family & Domain DBs
KEGG mpr:MPER_07328  -  
Pfam View protein in Pfam  
PF13233  Complex1_LYR_2  
Amino Acid Sequences MRYTLLRLAESVSTKPLNLQEASATLLPPIPLYRRLLRAHRFLPQEMRSLGDDYVKAGKSQIQTRKTEPCQRXKKXLRVQMFHGTNIGQVVRTS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.22
3 0.23
4 0.23
5 0.21
6 0.21
7 0.17
8 0.17
9 0.2
10 0.17
11 0.14
12 0.1
13 0.11
14 0.1
15 0.09
16 0.1
17 0.1
18 0.12
19 0.16
20 0.2
21 0.25
22 0.29
23 0.36
24 0.4
25 0.43
26 0.43
27 0.45
28 0.44
29 0.4
30 0.42
31 0.36
32 0.34
33 0.29
34 0.28
35 0.23
36 0.22
37 0.2
38 0.15
39 0.13
40 0.11
41 0.15
42 0.14
43 0.13
44 0.12
45 0.15
46 0.18
47 0.26
48 0.32
49 0.34
50 0.38
51 0.43
52 0.52
53 0.55
54 0.62
55 0.64
56 0.67
57 0.72
58 0.77
59 0.83
60 0.83
61 0.86
62 0.86
63 0.84
64 0.81
65 0.8
66 0.76
67 0.69
68 0.61
69 0.51
70 0.42
71 0.35
72 0.29