Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A428R8C8

Protein Details
Accession A0A428R8C8    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
81-108GVAILSQWSRRRRPRPRKALQDTPRGAVHydrophilic
NLS Segment(s)
PositionSequence
90-99RRRRPRPRKA
Subcellular Location(s) extr 17, plas 4, mito 2, E.R. 2
Family & Domain DBs
Amino Acid Sequences MKAIILLSLACLAVSLPSYAGTRQADLDLPDSIYESGNEENGIPFIRRIKAHLALADPTSLPAPTAATPSNAALSRKRGVGVAILSQWSRRRRPRPRKALQDTPRGAV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.06
3 0.06
4 0.07
5 0.09
6 0.09
7 0.14
8 0.15
9 0.15
10 0.15
11 0.16
12 0.16
13 0.16
14 0.18
15 0.14
16 0.13
17 0.12
18 0.12
19 0.12
20 0.1
21 0.09
22 0.09
23 0.09
24 0.09
25 0.09
26 0.08
27 0.07
28 0.08
29 0.08
30 0.07
31 0.07
32 0.1
33 0.12
34 0.12
35 0.15
36 0.19
37 0.21
38 0.22
39 0.23
40 0.21
41 0.19
42 0.19
43 0.18
44 0.13
45 0.1
46 0.09
47 0.07
48 0.06
49 0.05
50 0.06
51 0.06
52 0.09
53 0.09
54 0.1
55 0.11
56 0.11
57 0.14
58 0.14
59 0.16
60 0.16
61 0.2
62 0.21
63 0.21
64 0.21
65 0.19
66 0.18
67 0.19
68 0.18
69 0.16
70 0.15
71 0.16
72 0.16
73 0.19
74 0.26
75 0.29
76 0.37
77 0.45
78 0.54
79 0.64
80 0.76
81 0.83
82 0.87
83 0.91
84 0.94
85 0.93
86 0.93
87 0.9
88 0.9