Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A428QAB4

Protein Details
Accession A0A428QAB4    Localization Confidence Low Confidence Score 9.1
NoLS Segment(s)
PositionSequenceProtein Nature
3-29RLYHTKSKTGCARCRSRRVKVRSSQLHHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 13.5, mito 11, cyto_nucl 8.5
Family & Domain DBs
Amino Acid Sequences MPRLYHTKSKTGCARCRSRRVKVRSSQLHARSRVTDTYSVMKLGRFVAAVNDTKSIVTMIVHPRQRQGHPQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.73
2 0.73
3 0.81
4 0.81
5 0.82
6 0.83
7 0.83
8 0.83
9 0.81
10 0.82
11 0.8
12 0.78
13 0.77
14 0.75
15 0.74
16 0.67
17 0.6
18 0.52
19 0.46
20 0.41
21 0.34
22 0.27
23 0.21
24 0.22
25 0.21
26 0.19
27 0.17
28 0.15
29 0.14
30 0.13
31 0.12
32 0.08
33 0.08
34 0.1
35 0.13
36 0.15
37 0.15
38 0.16
39 0.15
40 0.15
41 0.15
42 0.13
43 0.1
44 0.08
45 0.13
46 0.19
47 0.27
48 0.33
49 0.34
50 0.4
51 0.46