Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A428P2M6

Protein Details
Accession A0A428P2M6    Localization Confidence Low Confidence Score 8.5
NoLS Segment(s)
PositionSequenceProtein Nature
74-102KAPAKKPEYKAPEKKPVYKAPAKKPEYKABasic
NLS Segment(s)
PositionSequence
56-103VKKPEHHNYKAPEKKPAYKAPAKKPEYKAPEKKPVYKAPAKKPEYKAP
Subcellular Location(s) extr 11, E.R. 5, cyto 3.5, cyto_nucl 3, mito 2, vacu 2, nucl 1.5
Family & Domain DBs
Amino Acid Sequences MKLSALTILAITTGILAAPVADPVAVASYGYEAPKNSYGSKEVNYGHKDEKKYTHVKKPEHHNYKAPEKKPAYKAPAKKPEYKAPEKKPVYKAPAKKPEYKAP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.04
2 0.03
3 0.03
4 0.03
5 0.04
6 0.04
7 0.04
8 0.04
9 0.04
10 0.04
11 0.05
12 0.05
13 0.04
14 0.04
15 0.06
16 0.07
17 0.08
18 0.09
19 0.08
20 0.11
21 0.15
22 0.17
23 0.16
24 0.17
25 0.19
26 0.21
27 0.22
28 0.23
29 0.22
30 0.27
31 0.27
32 0.29
33 0.32
34 0.34
35 0.35
36 0.33
37 0.36
38 0.35
39 0.43
40 0.45
41 0.48
42 0.51
43 0.55
44 0.59
45 0.66
46 0.7
47 0.69
48 0.68
49 0.65
50 0.63
51 0.68
52 0.7
53 0.61
54 0.6
55 0.57
56 0.61
57 0.62
58 0.64
59 0.62
60 0.62
61 0.69
62 0.7
63 0.76
64 0.73
65 0.75
66 0.73
67 0.74
68 0.75
69 0.77
70 0.76
71 0.74
72 0.8
73 0.78
74 0.8
75 0.79
76 0.79
77 0.77
78 0.77
79 0.77
80 0.77
81 0.81
82 0.79
83 0.8