Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A428Q4B9

Protein Details
Accession A0A428Q4B9    Localization Confidence High Confidence Score 16.4
NoLS Segment(s)
PositionSequenceProtein Nature
59-82ALTRTRRSFLRKKRRTLNHGRITPHydrophilic
NLS Segment(s)
PositionSequence
69-73RKKRR
163-171KGFMRKWRK
Subcellular Location(s) nucl 24.5, cyto_nucl 13.5
Family & Domain DBs
Amino Acid Sequences MAASPTDTTTTTTKPRRVPRDTGFPEPFNDVRNTTLPHPDADLSPNACISQEDIDPDRALTRTRRSFLRKKRRTLNHGRITPTSEALYSVLSLVSTDTGDNASIKQANPSMTSIRPSMSSIRPSMSSIRLSKDETESLASRNTRRDEETPPTSPDVPSYRSKKGFMRKWRKN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.5
2 0.6
3 0.66
4 0.7
5 0.74
6 0.72
7 0.76
8 0.75
9 0.75
10 0.71
11 0.62
12 0.57
13 0.54
14 0.48
15 0.4
16 0.36
17 0.28
18 0.26
19 0.27
20 0.28
21 0.25
22 0.31
23 0.28
24 0.27
25 0.27
26 0.25
27 0.23
28 0.23
29 0.24
30 0.18
31 0.18
32 0.17
33 0.15
34 0.14
35 0.13
36 0.12
37 0.11
38 0.1
39 0.12
40 0.14
41 0.15
42 0.15
43 0.15
44 0.15
45 0.13
46 0.15
47 0.17
48 0.23
49 0.27
50 0.29
51 0.36
52 0.43
53 0.52
54 0.61
55 0.68
56 0.68
57 0.71
58 0.79
59 0.81
60 0.83
61 0.84
62 0.84
63 0.81
64 0.78
65 0.73
66 0.64
67 0.58
68 0.5
69 0.4
70 0.29
71 0.2
72 0.15
73 0.12
74 0.11
75 0.07
76 0.06
77 0.05
78 0.04
79 0.04
80 0.04
81 0.04
82 0.04
83 0.04
84 0.04
85 0.04
86 0.05
87 0.05
88 0.05
89 0.07
90 0.08
91 0.08
92 0.1
93 0.12
94 0.13
95 0.14
96 0.16
97 0.17
98 0.17
99 0.19
100 0.18
101 0.16
102 0.16
103 0.17
104 0.2
105 0.21
106 0.23
107 0.22
108 0.23
109 0.24
110 0.25
111 0.26
112 0.25
113 0.27
114 0.25
115 0.28
116 0.29
117 0.3
118 0.31
119 0.31
120 0.28
121 0.24
122 0.27
123 0.23
124 0.22
125 0.26
126 0.26
127 0.26
128 0.32
129 0.34
130 0.33
131 0.37
132 0.4
133 0.41
134 0.47
135 0.5
136 0.48
137 0.47
138 0.48
139 0.45
140 0.41
141 0.4
142 0.36
143 0.33
144 0.38
145 0.41
146 0.46
147 0.48
148 0.52
149 0.56
150 0.62
151 0.67
152 0.7