Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A428QFJ2

Protein Details
Accession A0A428QFJ2    Localization Confidence High Confidence Score 15.6
NoLS Segment(s)
PositionSequenceProtein Nature
4-44IGPQLPPHLSKRKRTPERDASPPSNPSKHRRSESPTKNKDEHydrophilic
NLS Segment(s)
PositionSequence
14-21KRKRTPER
31-31K
Subcellular Location(s) nucl 22.5, cyto_nucl 14.5, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR022226  DUF3752  
IPR046331  GPAM1-like  
Pfam View protein in Pfam  
PF12572  DUF3752  
Amino Acid Sequences MSSIGPQLPPHLSKRKRTPERDASPPSNPSKHRRSESPTKNKDEIDLDDSDDDYGPSAPAPPKASIGPSLPPSNKDEIDLDSDSDSDTGPAPPKRIVGPAPPPADLSTRPDTGPDSDSDSEDDYGPALPGASNANKPTIGPQLPAAEPAPQRDSWMLAPPSASGYSERDPTKMRNRKFASKPASSSGPSTVSSIWTETPEEKLKRLQDSVLGRGDKTVETNPKAAIAKDEEERNRKISANIEAQRGKSLYAEHQARRDKDGENAEEEDDPSKRGFDREKDMAIGGKIGTAQRRELMNKAANFGGRFQKGSYL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.66
2 0.73
3 0.78
4 0.83
5 0.86
6 0.86
7 0.86
8 0.86
9 0.84
10 0.79
11 0.75
12 0.74
13 0.7
14 0.68
15 0.67
16 0.65
17 0.65
18 0.69
19 0.69
20 0.69
21 0.71
22 0.74
23 0.79
24 0.81
25 0.81
26 0.8
27 0.78
28 0.71
29 0.66
30 0.59
31 0.52
32 0.46
33 0.37
34 0.31
35 0.27
36 0.27
37 0.23
38 0.19
39 0.14
40 0.1
41 0.1
42 0.08
43 0.07
44 0.11
45 0.12
46 0.16
47 0.19
48 0.19
49 0.21
50 0.22
51 0.24
52 0.23
53 0.24
54 0.24
55 0.25
56 0.3
57 0.3
58 0.31
59 0.33
60 0.35
61 0.33
62 0.31
63 0.28
64 0.23
65 0.27
66 0.25
67 0.22
68 0.17
69 0.17
70 0.15
71 0.14
72 0.12
73 0.07
74 0.07
75 0.08
76 0.14
77 0.15
78 0.17
79 0.18
80 0.2
81 0.21
82 0.23
83 0.24
84 0.25
85 0.31
86 0.37
87 0.37
88 0.36
89 0.36
90 0.34
91 0.34
92 0.28
93 0.27
94 0.23
95 0.23
96 0.22
97 0.22
98 0.22
99 0.22
100 0.22
101 0.17
102 0.19
103 0.18
104 0.19
105 0.19
106 0.18
107 0.17
108 0.16
109 0.15
110 0.09
111 0.08
112 0.08
113 0.06
114 0.05
115 0.04
116 0.05
117 0.07
118 0.08
119 0.1
120 0.11
121 0.12
122 0.12
123 0.12
124 0.14
125 0.18
126 0.17
127 0.16
128 0.16
129 0.18
130 0.18
131 0.2
132 0.17
133 0.16
134 0.16
135 0.17
136 0.19
137 0.16
138 0.17
139 0.16
140 0.17
141 0.13
142 0.19
143 0.17
144 0.14
145 0.15
146 0.13
147 0.15
148 0.13
149 0.13
150 0.08
151 0.11
152 0.12
153 0.17
154 0.17
155 0.18
156 0.19
157 0.25
158 0.34
159 0.4
160 0.4
161 0.46
162 0.5
163 0.58
164 0.62
165 0.65
166 0.62
167 0.58
168 0.58
169 0.52
170 0.5
171 0.42
172 0.38
173 0.3
174 0.25
175 0.21
176 0.2
177 0.17
178 0.15
179 0.14
180 0.14
181 0.12
182 0.11
183 0.12
184 0.12
185 0.16
186 0.21
187 0.22
188 0.23
189 0.27
190 0.3
191 0.32
192 0.32
193 0.29
194 0.29
195 0.31
196 0.34
197 0.35
198 0.31
199 0.28
200 0.27
201 0.28
202 0.21
203 0.2
204 0.21
205 0.22
206 0.24
207 0.26
208 0.25
209 0.28
210 0.29
211 0.27
212 0.24
213 0.21
214 0.21
215 0.23
216 0.3
217 0.32
218 0.37
219 0.39
220 0.38
221 0.37
222 0.35
223 0.34
224 0.32
225 0.33
226 0.37
227 0.38
228 0.43
229 0.44
230 0.43
231 0.44
232 0.4
233 0.33
234 0.25
235 0.24
236 0.21
237 0.27
238 0.34
239 0.33
240 0.41
241 0.49
242 0.49
243 0.52
244 0.5
245 0.42
246 0.42
247 0.47
248 0.41
249 0.38
250 0.38
251 0.34
252 0.32
253 0.32
254 0.27
255 0.2
256 0.19
257 0.15
258 0.15
259 0.15
260 0.19
261 0.25
262 0.29
263 0.37
264 0.41
265 0.43
266 0.42
267 0.43
268 0.4
269 0.34
270 0.29
271 0.2
272 0.16
273 0.15
274 0.17
275 0.21
276 0.21
277 0.22
278 0.25
279 0.3
280 0.33
281 0.35
282 0.4
283 0.43
284 0.42
285 0.43
286 0.42
287 0.4
288 0.38
289 0.39
290 0.39
291 0.34
292 0.34