Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A428Q2L0

Protein Details
Accession A0A428Q2L0    Localization Confidence Medium Confidence Score 14.4
NoLS Segment(s)
PositionSequenceProtein Nature
6-30TISKNGCKPRGRPRKHPSDDQRMNVHydrophilic
NLS Segment(s)
PositionSequence
14-22PRGRPRKHP
Subcellular Location(s) nucl 24.5, cyto_nucl 13.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR004827  bZIP  
Gene Ontology GO:0003700  F:DNA-binding transcription factor activity  
Pfam View protein in Pfam  
PF07716  bZIP_2  
Amino Acid Sequences MNVDTTISKNGCKPRGRPRKHPSDDQRMNVRRERNRAAQKSFRLRHQANEQLQKQGDVELENKFNQLLSMFLSFTDQI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.56
2 0.66
3 0.72
4 0.77
5 0.78
6 0.82
7 0.82
8 0.85
9 0.83
10 0.83
11 0.82
12 0.77
13 0.78
14 0.73
15 0.71
16 0.65
17 0.64
18 0.59
19 0.59
20 0.58
21 0.57
22 0.61
23 0.63
24 0.64
25 0.63
26 0.63
27 0.67
28 0.63
29 0.59
30 0.58
31 0.53
32 0.52
33 0.53
34 0.55
35 0.51
36 0.58
37 0.54
38 0.51
39 0.5
40 0.45
41 0.38
42 0.3
43 0.24
44 0.17
45 0.18
46 0.15
47 0.18
48 0.18
49 0.18
50 0.16
51 0.15
52 0.14
53 0.12
54 0.1
55 0.1
56 0.11
57 0.11
58 0.11