Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A428P9M9

Protein Details
Accession A0A428P9M9    Localization Confidence Medium Confidence Score 14.1
NoLS Segment(s)
PositionSequenceProtein Nature
22-73LACVLCQQRKKKCDRKSPCSFCIKAKVTCIPSTPAPKRKRRKPTKELLERLEHydrophilic
NLS Segment(s)
PositionSequence
57-66PKRKRRKPTK
Subcellular Location(s) nucl 22, cyto_nucl 14
Family & Domain DBs
InterPro View protein in InterPro  
IPR036864  Zn2-C6_fun-type_DNA-bd_sf  
IPR001138  Zn2Cys6_DnaBD  
Gene Ontology GO:0005634  C:nucleus  
GO:0000981  F:DNA-binding transcription factor activity, RNA polymerase II-specific  
GO:0008270  F:zinc ion binding  
Pfam View protein in Pfam  
PF00172  Zn_clus  
PROSITE View protein in PROSITE  
PS50048  ZN2_CY6_FUNGAL_2  
CDD cd00067  GAL4  
Amino Acid Sequences MAALPTEQQQQSQRPTESKRILACVLCQQRKKKCDRKSPCSFCIKAKVTCIPSTPAPKRKRRKPTKELLERLERCEQLLKRCTCVQKSQMYEMPGHYSESNSSSPTDSHSSPPPEYEKVAPSSYEQHQQTFSSQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.47
2 0.53
3 0.59
4 0.59
5 0.58
6 0.54
7 0.52
8 0.51
9 0.45
10 0.41
11 0.41
12 0.45
13 0.47
14 0.51
15 0.55
16 0.6
17 0.68
18 0.76
19 0.76
20 0.76
21 0.8
22 0.83
23 0.85
24 0.87
25 0.87
26 0.84
27 0.83
28 0.75
29 0.68
30 0.67
31 0.62
32 0.53
33 0.48
34 0.47
35 0.42
36 0.41
37 0.39
38 0.32
39 0.31
40 0.38
41 0.41
42 0.44
43 0.49
44 0.58
45 0.66
46 0.73
47 0.8
48 0.82
49 0.86
50 0.85
51 0.88
52 0.89
53 0.89
54 0.84
55 0.78
56 0.77
57 0.68
58 0.63
59 0.57
60 0.46
61 0.37
62 0.38
63 0.34
64 0.32
65 0.39
66 0.35
67 0.34
68 0.39
69 0.43
70 0.4
71 0.44
72 0.43
73 0.42
74 0.44
75 0.46
76 0.44
77 0.41
78 0.39
79 0.34
80 0.33
81 0.26
82 0.25
83 0.2
84 0.17
85 0.17
86 0.19
87 0.19
88 0.15
89 0.16
90 0.15
91 0.15
92 0.18
93 0.21
94 0.19
95 0.22
96 0.28
97 0.32
98 0.32
99 0.36
100 0.36
101 0.34
102 0.36
103 0.36
104 0.33
105 0.32
106 0.33
107 0.3
108 0.28
109 0.31
110 0.32
111 0.38
112 0.35
113 0.34
114 0.35