Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A428PTN1

Protein Details
Accession A0A428PTN1    Localization Confidence Medium Confidence Score 13.5
NoLS Segment(s)
PositionSequenceProtein Nature
76-119IQAIKAKREKKEEKERYEKMAEKMHRKRVERLKRKEKRNKLINSBasic
NLS Segment(s)
PositionSequence
21-115MRKNGKQWHAPKKAFRPTAGLKSYEKRSQERALLAQIKAKEKEMKDEKEQIRQDRIQAIKAKREKKEEKERYEKMAEKMHRKRVERLKRKEKRNK
Subcellular Location(s) nucl 22, cyto_nucl 14, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR005579  Cgr1-like  
Gene Ontology GO:0005730  C:nucleolus  
GO:0006364  P:rRNA processing  
Pfam View protein in Pfam  
PF03879  Cgr1  
Amino Acid Sequences MSDTASPVPEPAPQAEKPLGMRKNGKQWHAPKKAFRPTAGLKSYEKRSQERALLAQIKAKEKEMKDEKEQIRQDRIQAIKAKREKKEEKERYEKMAEKMHRKRVERLKRKEKRNKLINS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.27
3 0.28
4 0.3
5 0.37
6 0.36
7 0.37
8 0.44
9 0.44
10 0.53
11 0.57
12 0.57
13 0.57
14 0.63
15 0.68
16 0.71
17 0.72
18 0.7
19 0.73
20 0.79
21 0.73
22 0.64
23 0.61
24 0.56
25 0.59
26 0.53
27 0.47
28 0.4
29 0.42
30 0.47
31 0.44
32 0.42
33 0.37
34 0.4
35 0.4
36 0.41
37 0.38
38 0.34
39 0.35
40 0.35
41 0.31
42 0.29
43 0.28
44 0.28
45 0.26
46 0.27
47 0.26
48 0.22
49 0.31
50 0.35
51 0.36
52 0.37
53 0.46
54 0.46
55 0.5
56 0.54
57 0.49
58 0.49
59 0.46
60 0.43
61 0.41
62 0.4
63 0.37
64 0.4
65 0.39
66 0.42
67 0.49
68 0.54
69 0.53
70 0.62
71 0.65
72 0.67
73 0.75
74 0.76
75 0.78
76 0.8
77 0.78
78 0.75
79 0.74
80 0.69
81 0.63
82 0.62
83 0.6
84 0.6
85 0.66
86 0.69
87 0.7
88 0.69
89 0.74
90 0.76
91 0.8
92 0.8
93 0.82
94 0.83
95 0.85
96 0.92
97 0.93
98 0.93
99 0.93