Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A428QZI7

Protein Details
Accession A0A428QZI7    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
59-78KSYRRRGIDRLGRVKKRARRBasic
NLS Segment(s)
PositionSequence
59-78KSYRRRGIDRLGRVKKRARR
Subcellular Location(s) mito 19, cyto 6
Family & Domain DBs
Amino Acid Sequences MSARPYNYYSTGSVYNTVLLLVRSSAARIADGRAVLKIGRITMGWVSSVSRAYARGSEKSYRRRGIDRLGRVKKRARR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.2
3 0.17
4 0.15
5 0.12
6 0.1
7 0.09
8 0.07
9 0.07
10 0.06
11 0.07
12 0.08
13 0.08
14 0.08
15 0.08
16 0.09
17 0.1
18 0.11
19 0.11
20 0.09
21 0.1
22 0.09
23 0.09
24 0.09
25 0.07
26 0.07
27 0.06
28 0.07
29 0.07
30 0.08
31 0.07
32 0.07
33 0.07
34 0.08
35 0.09
36 0.08
37 0.08
38 0.09
39 0.1
40 0.14
41 0.17
42 0.19
43 0.23
44 0.31
45 0.38
46 0.47
47 0.55
48 0.56
49 0.58
50 0.6
51 0.61
52 0.64
53 0.66
54 0.67
55 0.69
56 0.74
57 0.76
58 0.78