Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A428PNB3

Protein Details
Accession A0A428PNB3    Localization Confidence Medium Confidence Score 12.3
NoLS Segment(s)
PositionSequenceProtein Nature
113-151HDHGRRGRKSGKGKEKRAPSPNAYEKVPKPKPKDGPSGABasic
NLS Segment(s)
PositionSequence
115-147HGRRGRKSGKGKEKRAPSPNAYEKVPKPKPKDG
Subcellular Location(s) nucl 16.5, cyto_nucl 12, mito 5, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR011107  PPI_Ypi1  
Gene Ontology GO:0005634  C:nucleus  
GO:0004865  F:protein serine/threonine phosphatase inhibitor activity  
GO:0032515  P:negative regulation of phosphoprotein phosphatase activity  
Pfam View protein in Pfam  
PF07491  PPI_Ypi1  
Amino Acid Sequences MSQRQQQQNNAPAPAQTQTETPKEPETSEPAPRILRLRGAHSSNGRSVQWAEDVVDNEGLGRKSSKVCCIYHKPKPVDESSDESSSDSSSGSDSDSEPEGARPAAGKRQSCGHDHGRRGRKSGKGKEKRAPSPNAYEKVPKPKPKDGPSGASS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.36
2 0.3
3 0.22
4 0.21
5 0.23
6 0.27
7 0.29
8 0.29
9 0.31
10 0.3
11 0.31
12 0.31
13 0.33
14 0.33
15 0.36
16 0.35
17 0.34
18 0.34
19 0.34
20 0.34
21 0.29
22 0.31
23 0.28
24 0.31
25 0.34
26 0.36
27 0.39
28 0.4
29 0.41
30 0.38
31 0.38
32 0.33
33 0.28
34 0.26
35 0.22
36 0.19
37 0.16
38 0.14
39 0.13
40 0.14
41 0.13
42 0.12
43 0.11
44 0.1
45 0.11
46 0.1
47 0.09
48 0.09
49 0.09
50 0.13
51 0.15
52 0.21
53 0.24
54 0.25
55 0.32
56 0.41
57 0.47
58 0.51
59 0.58
60 0.54
61 0.52
62 0.54
63 0.49
64 0.44
65 0.39
66 0.36
67 0.31
68 0.3
69 0.27
70 0.23
71 0.22
72 0.18
73 0.15
74 0.09
75 0.06
76 0.05
77 0.05
78 0.06
79 0.06
80 0.06
81 0.08
82 0.09
83 0.09
84 0.09
85 0.09
86 0.1
87 0.09
88 0.09
89 0.09
90 0.1
91 0.16
92 0.21
93 0.22
94 0.22
95 0.29
96 0.32
97 0.34
98 0.38
99 0.41
100 0.43
101 0.5
102 0.58
103 0.62
104 0.61
105 0.65
106 0.65
107 0.64
108 0.67
109 0.7
110 0.72
111 0.73
112 0.79
113 0.81
114 0.84
115 0.85
116 0.83
117 0.8
118 0.74
119 0.74
120 0.74
121 0.7
122 0.64
123 0.62
124 0.6
125 0.63
126 0.67
127 0.66
128 0.65
129 0.71
130 0.78
131 0.77
132 0.81
133 0.77