Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A428NHB1

Protein Details
Accession A0A428NHB1    Localization Confidence Medium Confidence Score 14.2
NoLS Segment(s)
PositionSequenceProtein Nature
34-60LGGLRGRRSRICKRRRPKAPRYQAAGSHydrophilic
NLS Segment(s)
PositionSequence
19-54RTKGKKNGPGSPERRLGGLRGRRSRICKRRRPKAPR
Subcellular Location(s) nucl 24, cyto_nucl 14.5
Family & Domain DBs
Amino Acid Sequences MYGSSQPKSQISEMNLLARTKGKKNGPGSPERRLGGLRGRRSRICKRRRPKAPRYQAAGSRRHVTSSCGASDTAEEASSEAETDIPDSESDTPTDVIPCTQDAPSLVSVDCEKHHEEESNLGRLVDVYSTVE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.37
2 0.38
3 0.34
4 0.33
5 0.33
6 0.34
7 0.32
8 0.39
9 0.4
10 0.45
11 0.5
12 0.57
13 0.58
14 0.64
15 0.64
16 0.63
17 0.63
18 0.55
19 0.51
20 0.43
21 0.4
22 0.39
23 0.42
24 0.44
25 0.45
26 0.5
27 0.54
28 0.61
29 0.69
30 0.7
31 0.72
32 0.73
33 0.76
34 0.82
35 0.88
36 0.9
37 0.9
38 0.9
39 0.91
40 0.88
41 0.84
42 0.79
43 0.75
44 0.72
45 0.67
46 0.58
47 0.51
48 0.44
49 0.38
50 0.34
51 0.28
52 0.25
53 0.21
54 0.19
55 0.16
56 0.15
57 0.14
58 0.14
59 0.12
60 0.09
61 0.07
62 0.06
63 0.06
64 0.06
65 0.06
66 0.05
67 0.04
68 0.04
69 0.04
70 0.05
71 0.05
72 0.06
73 0.06
74 0.07
75 0.09
76 0.09
77 0.1
78 0.1
79 0.1
80 0.1
81 0.11
82 0.1
83 0.09
84 0.09
85 0.1
86 0.11
87 0.1
88 0.11
89 0.11
90 0.13
91 0.14
92 0.14
93 0.13
94 0.13
95 0.14
96 0.15
97 0.15
98 0.16
99 0.18
100 0.19
101 0.21
102 0.23
103 0.23
104 0.3
105 0.33
106 0.34
107 0.33
108 0.3
109 0.27
110 0.25
111 0.25
112 0.16