Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A428R498

Protein Details
Accession A0A428R498    Localization Confidence Medium Confidence Score 10.6
NoLS Segment(s)
PositionSequenceProtein Nature
80-108VKPSSGRIEKKRGDKRKQKKSKIVFASYAHydrophilic
NLS Segment(s)
PositionSequence
85-119GRIEKKRGDKRKQKKSKIVFASYASRSKGKKKRSS
Subcellular Location(s) mito 16.5, mito_nucl 14, nucl 10.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR019434  DUF2423  
Pfam View protein in Pfam  
PF10338  DUF2423  
Amino Acid Sequences MAKSSRSSTRKANNRRLVANVFGPAESARAERLSAKLLELAQQPKPESSDVKMSVDEDNEDSNEKEDAQEEVTTMDVDSVKPSSGRIEKKRGDKRKQKKSKIVFASYASRSKGKKKRSS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.77
2 0.76
3 0.73
4 0.66
5 0.59
6 0.51
7 0.43
8 0.34
9 0.28
10 0.25
11 0.19
12 0.16
13 0.13
14 0.12
15 0.1
16 0.09
17 0.1
18 0.11
19 0.12
20 0.15
21 0.14
22 0.14
23 0.15
24 0.14
25 0.17
26 0.2
27 0.22
28 0.21
29 0.24
30 0.24
31 0.23
32 0.24
33 0.22
34 0.2
35 0.18
36 0.22
37 0.21
38 0.22
39 0.21
40 0.21
41 0.2
42 0.18
43 0.17
44 0.11
45 0.1
46 0.09
47 0.1
48 0.08
49 0.08
50 0.08
51 0.08
52 0.07
53 0.07
54 0.07
55 0.08
56 0.08
57 0.07
58 0.07
59 0.07
60 0.07
61 0.06
62 0.06
63 0.05
64 0.06
65 0.07
66 0.07
67 0.07
68 0.07
69 0.08
70 0.13
71 0.2
72 0.29
73 0.34
74 0.43
75 0.49
76 0.6
77 0.7
78 0.75
79 0.79
80 0.81
81 0.86
82 0.87
83 0.92
84 0.92
85 0.92
86 0.91
87 0.91
88 0.89
89 0.85
90 0.78
91 0.71
92 0.68
93 0.63
94 0.58
95 0.51
96 0.48
97 0.45
98 0.51
99 0.56