Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A428NWH1

Protein Details
Accession A0A428NWH1    Localization Confidence Low Confidence Score 7.1
NoLS Segment(s)
PositionSequenceProtein Nature
21-41LAVRLLRTKRHPRHLKAAYRSHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 11.5, cyto_nucl 11, nucl 7.5, mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR003123  VPS9  
IPR045046  Vps9-like  
IPR037191  VPS9_dom_sf  
Gene Ontology GO:0005085  F:guanyl-nucleotide exchange factor activity  
GO:0016192  P:vesicle-mediated transport  
Pfam View protein in Pfam  
PF02204  VPS9  
PROSITE View protein in PROSITE  
PS51205  VPS9  
Amino Acid Sequences YLTGIVQVIFLPDSSLSEGPLAVRLLRTKRHPRHLKAAYRSIVDTLAHFHPSASADEIMPMLIYTLITLPPENLHVISDVYFVKTFRWELKLTGEAAYCLVNLEAAISFLETMALPTLKADEQLSGLAKSSSSPRSETFPPLSEPEEGPLSIQSA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.12
3 0.12
4 0.12
5 0.12
6 0.11
7 0.14
8 0.13
9 0.1
10 0.12
11 0.17
12 0.21
13 0.27
14 0.37
15 0.45
16 0.54
17 0.64
18 0.72
19 0.73
20 0.79
21 0.83
22 0.83
23 0.8
24 0.79
25 0.71
26 0.63
27 0.57
28 0.47
29 0.39
30 0.3
31 0.22
32 0.17
33 0.16
34 0.15
35 0.14
36 0.13
37 0.13
38 0.14
39 0.15
40 0.13
41 0.12
42 0.1
43 0.11
44 0.11
45 0.09
46 0.08
47 0.06
48 0.04
49 0.03
50 0.03
51 0.03
52 0.04
53 0.04
54 0.04
55 0.05
56 0.05
57 0.05
58 0.06
59 0.07
60 0.06
61 0.06
62 0.07
63 0.07
64 0.07
65 0.08
66 0.07
67 0.08
68 0.08
69 0.08
70 0.08
71 0.09
72 0.1
73 0.11
74 0.15
75 0.14
76 0.15
77 0.18
78 0.2
79 0.2
80 0.2
81 0.18
82 0.14
83 0.14
84 0.13
85 0.09
86 0.07
87 0.06
88 0.04
89 0.04
90 0.05
91 0.04
92 0.04
93 0.04
94 0.04
95 0.04
96 0.04
97 0.05
98 0.04
99 0.04
100 0.05
101 0.06
102 0.05
103 0.06
104 0.08
105 0.07
106 0.09
107 0.09
108 0.08
109 0.09
110 0.12
111 0.13
112 0.12
113 0.12
114 0.11
115 0.11
116 0.11
117 0.16
118 0.18
119 0.19
120 0.22
121 0.23
122 0.28
123 0.32
124 0.37
125 0.37
126 0.35
127 0.37
128 0.37
129 0.38
130 0.35
131 0.32
132 0.29
133 0.27
134 0.24
135 0.21