Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A428NRM1

Protein Details
Accession A0A428NRM1    Localization Confidence Low Confidence Score 9.3
NoLS Segment(s)
PositionSequenceProtein Nature
93-119VDGLRKPSLRACRKQHKQYYWKRPKTPHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 15, cyto_nucl 12, mito 8
Family & Domain DBs
Amino Acid Sequences MSYESNPIVANHVINQLAYSRLSSTPLSTIMQHLPTEEKKGLDKADLRDVIESTPCIGIIKRQGKDAAGKPLESEYYYVPEQDDDEQRRAAVVDGLRKPSLRACRKQHKQYYWKRPKTP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.17
3 0.14
4 0.14
5 0.14
6 0.12
7 0.12
8 0.12
9 0.15
10 0.15
11 0.15
12 0.15
13 0.17
14 0.17
15 0.15
16 0.18
17 0.18
18 0.2
19 0.18
20 0.17
21 0.2
22 0.2
23 0.24
24 0.23
25 0.21
26 0.21
27 0.23
28 0.23
29 0.23
30 0.26
31 0.23
32 0.3
33 0.3
34 0.28
35 0.26
36 0.26
37 0.22
38 0.19
39 0.16
40 0.09
41 0.08
42 0.07
43 0.07
44 0.06
45 0.08
46 0.16
47 0.22
48 0.22
49 0.24
50 0.24
51 0.25
52 0.31
53 0.32
54 0.33
55 0.27
56 0.26
57 0.25
58 0.26
59 0.25
60 0.2
61 0.18
62 0.1
63 0.13
64 0.13
65 0.13
66 0.12
67 0.11
68 0.12
69 0.15
70 0.21
71 0.21
72 0.23
73 0.23
74 0.23
75 0.23
76 0.22
77 0.19
78 0.16
79 0.15
80 0.21
81 0.24
82 0.29
83 0.3
84 0.3
85 0.3
86 0.33
87 0.41
88 0.42
89 0.48
90 0.55
91 0.65
92 0.75
93 0.85
94 0.88
95 0.88
96 0.9
97 0.91
98 0.93
99 0.93