Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A428Q9U5

Protein Details
Accession A0A428Q9U5    Localization Confidence High Confidence Score 15.3
NoLS Segment(s)
PositionSequenceProtein Nature
255-280SEIAAARERERRRRERQMVEPRQERTHydrophilic
NLS Segment(s)
PositionSequence
266-267RR
Subcellular Location(s) nucl 19, cyto 5, cysk 2
Family & Domain DBs
Amino Acid Sequences MASNATSNNNEPLASIVFPGPYAATFYFNNDLAEGPDYLLSSDGGYLTDDSDTSEEEEQEKLPPASYMSEFPVVEGNPWPASSPASTPSLTSSMQTQTSSMDHEQSPKDQIGASGPSFTHVGSTSPEIEVNTDGHVPLVEPSEGVVDNGTNQTLGAFEAQLPIEKRFPAHFVNFVDWKDPIPFEEFVKLSAQHRSETRAIQWDSQAWFKTIFERGSIKYKQELAEWRAARLRHITGIPIDQDQADEVGYVMYRVSEIAAARERERRRRERQMVEPRQERTLTEF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.16
3 0.14
4 0.13
5 0.13
6 0.13
7 0.11
8 0.09
9 0.13
10 0.12
11 0.14
12 0.15
13 0.19
14 0.22
15 0.22
16 0.23
17 0.19
18 0.19
19 0.17
20 0.18
21 0.14
22 0.11
23 0.11
24 0.11
25 0.11
26 0.11
27 0.09
28 0.07
29 0.07
30 0.07
31 0.06
32 0.07
33 0.07
34 0.07
35 0.07
36 0.07
37 0.08
38 0.08
39 0.09
40 0.1
41 0.11
42 0.11
43 0.12
44 0.13
45 0.13
46 0.14
47 0.17
48 0.15
49 0.14
50 0.14
51 0.14
52 0.16
53 0.17
54 0.16
55 0.16
56 0.2
57 0.19
58 0.19
59 0.21
60 0.18
61 0.17
62 0.17
63 0.16
64 0.13
65 0.13
66 0.14
67 0.11
68 0.13
69 0.12
70 0.12
71 0.12
72 0.15
73 0.15
74 0.15
75 0.16
76 0.18
77 0.17
78 0.16
79 0.16
80 0.16
81 0.17
82 0.17
83 0.15
84 0.13
85 0.14
86 0.17
87 0.15
88 0.15
89 0.15
90 0.18
91 0.19
92 0.2
93 0.22
94 0.18
95 0.18
96 0.15
97 0.15
98 0.14
99 0.15
100 0.14
101 0.12
102 0.12
103 0.13
104 0.13
105 0.12
106 0.11
107 0.08
108 0.08
109 0.08
110 0.1
111 0.1
112 0.1
113 0.11
114 0.1
115 0.1
116 0.1
117 0.09
118 0.08
119 0.08
120 0.07
121 0.07
122 0.06
123 0.06
124 0.06
125 0.06
126 0.05
127 0.05
128 0.05
129 0.06
130 0.06
131 0.06
132 0.05
133 0.04
134 0.05
135 0.05
136 0.05
137 0.04
138 0.04
139 0.04
140 0.04
141 0.04
142 0.04
143 0.04
144 0.04
145 0.06
146 0.06
147 0.08
148 0.09
149 0.11
150 0.12
151 0.12
152 0.13
153 0.13
154 0.17
155 0.18
156 0.18
157 0.21
158 0.21
159 0.25
160 0.26
161 0.25
162 0.23
163 0.2
164 0.19
165 0.16
166 0.15
167 0.12
168 0.13
169 0.14
170 0.14
171 0.17
172 0.16
173 0.16
174 0.18
175 0.18
176 0.16
177 0.22
178 0.22
179 0.2
180 0.21
181 0.25
182 0.26
183 0.27
184 0.28
185 0.3
186 0.31
187 0.3
188 0.31
189 0.29
190 0.29
191 0.31
192 0.29
193 0.22
194 0.21
195 0.19
196 0.22
197 0.22
198 0.21
199 0.2
200 0.23
201 0.24
202 0.31
203 0.34
204 0.33
205 0.32
206 0.35
207 0.34
208 0.35
209 0.4
210 0.37
211 0.43
212 0.41
213 0.39
214 0.4
215 0.39
216 0.37
217 0.34
218 0.31
219 0.26
220 0.26
221 0.26
222 0.24
223 0.27
224 0.26
225 0.23
226 0.21
227 0.17
228 0.17
229 0.15
230 0.13
231 0.09
232 0.07
233 0.06
234 0.06
235 0.06
236 0.06
237 0.05
238 0.05
239 0.05
240 0.05
241 0.05
242 0.07
243 0.08
244 0.13
245 0.19
246 0.22
247 0.25
248 0.33
249 0.41
250 0.49
251 0.59
252 0.64
253 0.68
254 0.77
255 0.84
256 0.85
257 0.88
258 0.89
259 0.9
260 0.9
261 0.87
262 0.79
263 0.75
264 0.67