Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G7XNM8

Protein Details
Accession G7XNM8   
Localization Confidence Medium
Confidence Score 11.5
NoLS Segment(s)
PositionSequenceProtein Nature
1-45MAKERTEKKDKREKKEKRAEKDGVSKTSKKEKKEKKDKVALADAVBasic
NLS Segment(s)
PositionSequence
5-38RTEKKDKREKKEKRAEKDGVSKTSKKEKKEKKDK
Subcellular Location(s) nucl 16, cyto_nucl 11.833, mito_nucl 10.833, cyto 6.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR029064  L30e-like  
IPR004038  Ribosomal_L7Ae/L30e/S12e/Gad45  
IPR004037  Ribosomal_L7Ae_CS  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0042254  P:ribosome biogenesis  
Pfam View protein in Pfam  
PF01248  Ribosomal_L7Ae  
PROSITE View protein in PROSITE  
PS01082  RIBOSOMAL_L7AE  
Amino Acid Sequences MAKERTEKKDKREKKEKRAEKDGVSKTSKKEKKEKKDKVALADAVEKELTTKVLDGLDQAATEAPVNGAETERMDVDSRPVGAVVPFASPLVEDKNAKKVLKSVKKAAVNKCLKRGVKEVVKALRKSPIPAANASIGVPNGVVILAADISPMDVISHIPVLCEDHGIPYVFVTSRAELGNSAATKRPTSVVMVVPKSASKGKKKDGEDDGEDFTEVFEELAKLAQKEAKKVNL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.88
2 0.93
3 0.92
4 0.91
5 0.91
6 0.87
7 0.84
8 0.84
9 0.8
10 0.77
11 0.74
12 0.69
13 0.65
14 0.69
15 0.66
16 0.64
17 0.67
18 0.7
19 0.74
20 0.81
21 0.86
22 0.85
23 0.9
24 0.87
25 0.84
26 0.8
27 0.71
28 0.62
29 0.58
30 0.47
31 0.38
32 0.33
33 0.25
34 0.18
35 0.17
36 0.15
37 0.09
38 0.09
39 0.09
40 0.09
41 0.09
42 0.09
43 0.1
44 0.09
45 0.09
46 0.09
47 0.07
48 0.07
49 0.07
50 0.07
51 0.05
52 0.05
53 0.06
54 0.06
55 0.06
56 0.06
57 0.07
58 0.08
59 0.08
60 0.09
61 0.09
62 0.09
63 0.11
64 0.11
65 0.11
66 0.1
67 0.1
68 0.09
69 0.08
70 0.09
71 0.07
72 0.06
73 0.06
74 0.06
75 0.06
76 0.06
77 0.07
78 0.09
79 0.1
80 0.12
81 0.13
82 0.21
83 0.25
84 0.26
85 0.25
86 0.28
87 0.36
88 0.43
89 0.47
90 0.46
91 0.48
92 0.55
93 0.62
94 0.62
95 0.62
96 0.61
97 0.59
98 0.59
99 0.59
100 0.52
101 0.49
102 0.47
103 0.43
104 0.4
105 0.4
106 0.4
107 0.4
108 0.44
109 0.42
110 0.39
111 0.38
112 0.33
113 0.32
114 0.33
115 0.31
116 0.27
117 0.27
118 0.28
119 0.23
120 0.23
121 0.21
122 0.16
123 0.11
124 0.09
125 0.08
126 0.05
127 0.04
128 0.04
129 0.03
130 0.02
131 0.03
132 0.03
133 0.03
134 0.03
135 0.03
136 0.03
137 0.03
138 0.03
139 0.03
140 0.03
141 0.03
142 0.04
143 0.06
144 0.06
145 0.06
146 0.07
147 0.09
148 0.09
149 0.1
150 0.09
151 0.09
152 0.11
153 0.12
154 0.11
155 0.09
156 0.11
157 0.1
158 0.11
159 0.11
160 0.1
161 0.11
162 0.12
163 0.12
164 0.1
165 0.12
166 0.15
167 0.14
168 0.15
169 0.18
170 0.19
171 0.2
172 0.2
173 0.21
174 0.17
175 0.2
176 0.22
177 0.24
178 0.29
179 0.3
180 0.3
181 0.29
182 0.28
183 0.28
184 0.32
185 0.33
186 0.36
187 0.42
188 0.51
189 0.58
190 0.62
191 0.67
192 0.68
193 0.68
194 0.64
195 0.59
196 0.53
197 0.45
198 0.42
199 0.33
200 0.25
201 0.18
202 0.13
203 0.09
204 0.06
205 0.06
206 0.06
207 0.1
208 0.12
209 0.12
210 0.14
211 0.2
212 0.22
213 0.29