Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A428R2V4

Protein Details
Accession A0A428R2V4    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
74-109FPRLSRKEKKALKEQKKREKEQKKAAKKARKQGSYEBasic
NLS Segment(s)
PositionSequence
76-104RLSRKEKKALKEQKKREKEQKKAAKKARK
Subcellular Location(s) plas 9, mito 8, E.R. 4, cyto_mito 4, mito_nucl 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR007568  RTA1  
Gene Ontology GO:0016020  C:membrane  
Pfam View protein in Pfam  
PF04479  RTA1  
Amino Acid Sequences MKWLILTMLLVLILIIIRIVYRLVEFGPGVDEHNELLTHEGYPLGLDAFPILFALVLLNVMHPGFVLRGPDSEFPRLSRKEKKALKEQKKREKEQKKAAKKARKQGSYELENRFIDEDRSTSGRELL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.03
2 0.03
3 0.03
4 0.03
5 0.03
6 0.04
7 0.04
8 0.05
9 0.06
10 0.06
11 0.08
12 0.08
13 0.08
14 0.1
15 0.1
16 0.11
17 0.11
18 0.11
19 0.1
20 0.11
21 0.1
22 0.08
23 0.1
24 0.09
25 0.08
26 0.08
27 0.08
28 0.07
29 0.07
30 0.07
31 0.05
32 0.04
33 0.04
34 0.04
35 0.04
36 0.04
37 0.04
38 0.04
39 0.03
40 0.03
41 0.03
42 0.03
43 0.03
44 0.03
45 0.03
46 0.03
47 0.03
48 0.03
49 0.03
50 0.03
51 0.04
52 0.04
53 0.05
54 0.05
55 0.06
56 0.09
57 0.13
58 0.15
59 0.18
60 0.18
61 0.19
62 0.26
63 0.29
64 0.33
65 0.39
66 0.42
67 0.49
68 0.55
69 0.59
70 0.64
71 0.71
72 0.76
73 0.77
74 0.82
75 0.83
76 0.87
77 0.89
78 0.89
79 0.89
80 0.88
81 0.88
82 0.88
83 0.88
84 0.89
85 0.9
86 0.9
87 0.88
88 0.88
89 0.87
90 0.84
91 0.77
92 0.76
93 0.75
94 0.72
95 0.71
96 0.66
97 0.62
98 0.55
99 0.51
100 0.44
101 0.36
102 0.3
103 0.25
104 0.21
105 0.19
106 0.22
107 0.22