Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A428QKL0

Protein Details
Accession A0A428QKL0    Localization Confidence Low Confidence Score 9.6
NoLS Segment(s)
PositionSequenceProtein Nature
15-40LLTSILPGRRRRKPHKPRYTVENPQVHydrophilic
NLS Segment(s)
PositionSequence
22-31GRRRRKPHKP
Subcellular Location(s) mito 18.5, mito_nucl 13.333, nucl 7, cyto_nucl 4.833
Family & Domain DBs
Amino Acid Sequences MSTPIHKEWRKLKDLLTSILPGRRRRKPHKPRYTVENPQVIFCQKIHPDALCELLESKFQKRFFVQMHNDTWRIHAPRHLAMHEFDCCRVP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.56
2 0.52
3 0.46
4 0.4
5 0.37
6 0.39
7 0.41
8 0.4
9 0.45
10 0.5
11 0.57
12 0.64
13 0.72
14 0.78
15 0.84
16 0.87
17 0.87
18 0.84
19 0.83
20 0.83
21 0.8
22 0.75
23 0.7
24 0.59
25 0.51
26 0.48
27 0.39
28 0.31
29 0.22
30 0.2
31 0.14
32 0.16
33 0.16
34 0.15
35 0.15
36 0.15
37 0.17
38 0.12
39 0.12
40 0.11
41 0.11
42 0.14
43 0.15
44 0.18
45 0.21
46 0.21
47 0.24
48 0.24
49 0.3
50 0.29
51 0.37
52 0.41
53 0.41
54 0.46
55 0.48
56 0.49
57 0.43
58 0.43
59 0.41
60 0.36
61 0.32
62 0.31
63 0.31
64 0.35
65 0.39
66 0.39
67 0.34
68 0.34
69 0.36
70 0.37
71 0.35