Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A428QLW6

Protein Details
Accession A0A428QLW6    Localization Confidence Medium Confidence Score 13.1
NoLS Segment(s)
PositionSequenceProtein Nature
130-158QVTPSDESVNKKRKNKNKNKKQKAKSAEEHydrophilic
NLS Segment(s)
PositionSequence
140-155KKRKNKNKNKKQKAKS
Subcellular Location(s) nucl 18.5, cyto_nucl 10, mito 8
Family & Domain DBs
Amino Acid Sequences MAPDPAPPLPLAANRAALSNRISLLLASQSSVLKTMNLSKPPTTKRRAIPEDDNDDDLVRGSRPNEGVGYVPDKKDAQKIGNAKEERMLRGRLVGKSVKKRAESTENIEEKTVDGDVSMKDDDVKDEAQQVTPSDESVNKKRKNKNKNKKQKAKSAEE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.25
3 0.24
4 0.23
5 0.22
6 0.2
7 0.19
8 0.16
9 0.16
10 0.13
11 0.14
12 0.14
13 0.12
14 0.11
15 0.12
16 0.11
17 0.11
18 0.13
19 0.11
20 0.09
21 0.1
22 0.18
23 0.23
24 0.27
25 0.3
26 0.33
27 0.4
28 0.48
29 0.54
30 0.52
31 0.53
32 0.55
33 0.62
34 0.64
35 0.63
36 0.63
37 0.63
38 0.64
39 0.59
40 0.53
41 0.43
42 0.37
43 0.31
44 0.23
45 0.16
46 0.09
47 0.08
48 0.07
49 0.1
50 0.1
51 0.11
52 0.11
53 0.11
54 0.11
55 0.12
56 0.16
57 0.15
58 0.15
59 0.15
60 0.16
61 0.16
62 0.19
63 0.2
64 0.17
65 0.21
66 0.25
67 0.28
68 0.35
69 0.35
70 0.31
71 0.33
72 0.33
73 0.3
74 0.29
75 0.26
76 0.18
77 0.23
78 0.26
79 0.22
80 0.25
81 0.28
82 0.32
83 0.39
84 0.46
85 0.46
86 0.45
87 0.46
88 0.48
89 0.5
90 0.48
91 0.46
92 0.5
93 0.47
94 0.45
95 0.43
96 0.37
97 0.29
98 0.26
99 0.19
100 0.09
101 0.06
102 0.07
103 0.07
104 0.1
105 0.1
106 0.08
107 0.1
108 0.1
109 0.11
110 0.13
111 0.13
112 0.11
113 0.16
114 0.17
115 0.17
116 0.18
117 0.18
118 0.19
119 0.18
120 0.18
121 0.15
122 0.2
123 0.25
124 0.33
125 0.43
126 0.47
127 0.56
128 0.66
129 0.74
130 0.81
131 0.86
132 0.87
133 0.89
134 0.92
135 0.95
136 0.96
137 0.95
138 0.95