Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A428QMK5

Protein Details
Accession A0A428QMK5    Localization Confidence High Confidence Score 16.5
NoLS Segment(s)
PositionSequenceProtein Nature
65-92CREGRNGKSKERYKKKKKQGICVDCPNRBasic
117-142SLCGSCRKVPPQYRKIDKCPDCKDRLHydrophilic
NLS Segment(s)
PositionSequence
69-82RNGKSKERYKKKKK
Subcellular Location(s) nucl 25.5, cyto_nucl 13.5
Family & Domain DBs
Amino Acid Sequences MSYRAPLSYGPNEKAKEAPTGGYNFGEAKPSYGSGYDYEEADPGTKKCDRCPKRVPLDVEMCDCCREGRNGKSKERYKKKKKQGICVDCPNRAAPGSTRCLPCKLKHLESEVNRLMSLCGSCRKVPPQYRKIDKCPDCKDRLKEYEDSAS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.44
2 0.4
3 0.36
4 0.31
5 0.29
6 0.26
7 0.28
8 0.28
9 0.25
10 0.24
11 0.2
12 0.19
13 0.21
14 0.17
15 0.16
16 0.15
17 0.16
18 0.16
19 0.15
20 0.16
21 0.13
22 0.18
23 0.17
24 0.16
25 0.16
26 0.15
27 0.15
28 0.15
29 0.15
30 0.1
31 0.14
32 0.18
33 0.18
34 0.25
35 0.36
36 0.4
37 0.47
38 0.56
39 0.61
40 0.66
41 0.72
42 0.69
43 0.64
44 0.65
45 0.58
46 0.52
47 0.44
48 0.36
49 0.3
50 0.26
51 0.19
52 0.14
53 0.16
54 0.18
55 0.24
56 0.33
57 0.38
58 0.44
59 0.53
60 0.6
61 0.67
62 0.73
63 0.76
64 0.78
65 0.83
66 0.87
67 0.87
68 0.86
69 0.86
70 0.86
71 0.84
72 0.8
73 0.81
74 0.74
75 0.67
76 0.62
77 0.51
78 0.41
79 0.32
80 0.26
81 0.19
82 0.19
83 0.23
84 0.26
85 0.29
86 0.3
87 0.35
88 0.38
89 0.37
90 0.41
91 0.43
92 0.43
93 0.44
94 0.49
95 0.51
96 0.51
97 0.57
98 0.51
99 0.45
100 0.4
101 0.36
102 0.3
103 0.23
104 0.2
105 0.15
106 0.17
107 0.2
108 0.22
109 0.26
110 0.32
111 0.4
112 0.49
113 0.57
114 0.61
115 0.68
116 0.77
117 0.8
118 0.83
119 0.84
120 0.83
121 0.82
122 0.82
123 0.81
124 0.78
125 0.8
126 0.79
127 0.78
128 0.77
129 0.72
130 0.67