Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A428P5B7

Protein Details
Accession A0A428P5B7    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
52-72AIYVTQKKRAKERKAKETGAAHydrophilic
NLS Segment(s)
PositionSequence
58-67KKRAKERKAK
Subcellular Location(s) cyto 15, cyto_nucl 9.5, mito 5, E.R. 4
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MDVVFGPFEQPYGVNSTTDTTKESKKAQDPSKAIAIVLLVMLGLFLAALAVAIYVTQKKRAKERKAKETGAATPQEIA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.15
3 0.17
4 0.18
5 0.18
6 0.19
7 0.17
8 0.2
9 0.24
10 0.27
11 0.31
12 0.37
13 0.45
14 0.49
15 0.54
16 0.53
17 0.52
18 0.52
19 0.45
20 0.38
21 0.3
22 0.23
23 0.14
24 0.11
25 0.07
26 0.03
27 0.02
28 0.02
29 0.02
30 0.02
31 0.01
32 0.01
33 0.01
34 0.01
35 0.01
36 0.01
37 0.02
38 0.02
39 0.02
40 0.03
41 0.07
42 0.08
43 0.17
44 0.21
45 0.25
46 0.36
47 0.47
48 0.57
49 0.64
50 0.74
51 0.76
52 0.82
53 0.82
54 0.78
55 0.73
56 0.68
57 0.64
58 0.57