Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A428QVZ1

Protein Details
Accession A0A428QVZ1    Localization Confidence High Confidence Score 18.3
NoLS Segment(s)
PositionSequenceProtein Nature
12-41GGALKLKGSKVHKKKKKRDKKTDLEKNLDTBasic
NLS Segment(s)
PositionSequence
16-38KLKGSKVHKKKKKRDKKTDLEKN
42-47GKREGP
51-52RK
87-89KKK
Subcellular Location(s) nucl 25, cyto_nucl 14.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR013865  FAM32A  
Pfam View protein in Pfam  
PF08555  FAM32A  
Amino Acid Sequences MASDDYTAVSGGGALKLKGSKVHKKKKKRDKKTDLEKNLDTGKREGPDPDRKKNKEVDDEDQPREEEEDDRSAAQKTEAEKRHDEIKKKRLLKLAESSGSRPELLKTHKERVEELNTYLSRLSEHHDMPRIGPG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.11
3 0.13
4 0.14
5 0.2
6 0.27
7 0.36
8 0.45
9 0.57
10 0.65
11 0.75
12 0.85
13 0.9
14 0.93
15 0.94
16 0.94
17 0.94
18 0.95
19 0.95
20 0.95
21 0.93
22 0.89
23 0.78
24 0.71
25 0.67
26 0.59
27 0.5
28 0.41
29 0.36
30 0.29
31 0.29
32 0.29
33 0.29
34 0.37
35 0.42
36 0.49
37 0.56
38 0.57
39 0.61
40 0.64
41 0.63
42 0.62
43 0.6
44 0.54
45 0.54
46 0.56
47 0.53
48 0.47
49 0.41
50 0.32
51 0.28
52 0.24
53 0.15
54 0.11
55 0.12
56 0.11
57 0.11
58 0.12
59 0.12
60 0.11
61 0.11
62 0.11
63 0.12
64 0.2
65 0.25
66 0.29
67 0.3
68 0.32
69 0.41
70 0.44
71 0.5
72 0.51
73 0.55
74 0.59
75 0.62
76 0.66
77 0.63
78 0.62
79 0.6
80 0.58
81 0.56
82 0.52
83 0.49
84 0.45
85 0.42
86 0.39
87 0.33
88 0.25
89 0.2
90 0.22
91 0.25
92 0.33
93 0.36
94 0.44
95 0.47
96 0.48
97 0.49
98 0.5
99 0.53
100 0.46
101 0.42
102 0.41
103 0.38
104 0.37
105 0.35
106 0.28
107 0.21
108 0.19
109 0.22
110 0.2
111 0.23
112 0.28
113 0.35
114 0.36