Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A428PSF5

Protein Details
Accession A0A428PSF5    Localization Confidence Medium Confidence Score 14.2
NoLS Segment(s)
PositionSequenceProtein Nature
224-251VEEPEPKRPKKPVRKAGKSRASKRKAPABasic
NLS Segment(s)
PositionSequence
229-254PKRPKKPVRKAGKSRASKRKAPASKR
338-340KKS
Subcellular Location(s) nucl 20, mito_nucl 12.333, cyto_nucl 11.833, mito 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR014751  XRCC4-like_C  
Amino Acid Sequences MAPIRVLRFARSDDKSAFVLVQVTPKGSKPLDLELVGTEGEAPYVASLKHDRVVSLRVKNCPASEDEWQSILEALFQQEPVPDIQATATVQSDKSISITIRKEIQGITQRLGAVALNYDPDEAIELFEWCGAAVESSATSKQAVADLTVKSADSEAAVAQLQSQLEELLRAKDEDETALLRKFRDLLNEKKVKIREQQQVLASTTFNASMPGHSQPSESVEIKVEEPEPKRPKKPVRKAGKSRASKRKAPASKRVEESEEEDMQSMDVDIKEEPEDTDPGNTTEATASVSGDDEDDAEVLSSSSQQRAVSEPAAPQEEAPPQVSQPPPRRELPFALRKKSAKPAPPPAGSDTDSDDEL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.42
2 0.4
3 0.37
4 0.32
5 0.24
6 0.22
7 0.18
8 0.22
9 0.19
10 0.21
11 0.21
12 0.22
13 0.28
14 0.25
15 0.29
16 0.26
17 0.31
18 0.33
19 0.32
20 0.31
21 0.26
22 0.27
23 0.22
24 0.19
25 0.13
26 0.08
27 0.08
28 0.06
29 0.05
30 0.04
31 0.06
32 0.06
33 0.09
34 0.13
35 0.15
36 0.19
37 0.2
38 0.21
39 0.22
40 0.29
41 0.33
42 0.39
43 0.42
44 0.43
45 0.47
46 0.49
47 0.47
48 0.43
49 0.39
50 0.34
51 0.35
52 0.35
53 0.33
54 0.3
55 0.3
56 0.27
57 0.25
58 0.2
59 0.15
60 0.1
61 0.1
62 0.1
63 0.1
64 0.1
65 0.09
66 0.11
67 0.1
68 0.11
69 0.09
70 0.09
71 0.09
72 0.1
73 0.1
74 0.1
75 0.11
76 0.1
77 0.1
78 0.1
79 0.11
80 0.09
81 0.1
82 0.11
83 0.11
84 0.16
85 0.19
86 0.2
87 0.24
88 0.25
89 0.25
90 0.23
91 0.29
92 0.32
93 0.32
94 0.31
95 0.28
96 0.28
97 0.26
98 0.26
99 0.19
100 0.11
101 0.09
102 0.08
103 0.06
104 0.07
105 0.07
106 0.06
107 0.06
108 0.07
109 0.06
110 0.07
111 0.06
112 0.07
113 0.06
114 0.07
115 0.07
116 0.05
117 0.05
118 0.04
119 0.04
120 0.04
121 0.04
122 0.04
123 0.05
124 0.06
125 0.06
126 0.06
127 0.06
128 0.07
129 0.08
130 0.08
131 0.08
132 0.11
133 0.11
134 0.11
135 0.11
136 0.11
137 0.1
138 0.1
139 0.08
140 0.05
141 0.05
142 0.04
143 0.05
144 0.05
145 0.05
146 0.05
147 0.06
148 0.06
149 0.06
150 0.06
151 0.05
152 0.05
153 0.07
154 0.07
155 0.07
156 0.07
157 0.07
158 0.08
159 0.08
160 0.08
161 0.07
162 0.08
163 0.08
164 0.09
165 0.11
166 0.11
167 0.11
168 0.11
169 0.12
170 0.12
171 0.19
172 0.23
173 0.28
174 0.37
175 0.42
176 0.43
177 0.47
178 0.49
179 0.45
180 0.46
181 0.48
182 0.46
183 0.45
184 0.49
185 0.46
186 0.46
187 0.43
188 0.38
189 0.29
190 0.21
191 0.17
192 0.13
193 0.1
194 0.09
195 0.08
196 0.07
197 0.1
198 0.11
199 0.12
200 0.12
201 0.12
202 0.11
203 0.15
204 0.18
205 0.17
206 0.16
207 0.16
208 0.17
209 0.17
210 0.18
211 0.16
212 0.18
213 0.19
214 0.28
215 0.35
216 0.4
217 0.45
218 0.53
219 0.62
220 0.68
221 0.77
222 0.77
223 0.8
224 0.85
225 0.9
226 0.91
227 0.91
228 0.89
229 0.89
230 0.89
231 0.85
232 0.81
233 0.77
234 0.77
235 0.77
236 0.74
237 0.75
238 0.72
239 0.73
240 0.7
241 0.66
242 0.59
243 0.51
244 0.48
245 0.43
246 0.36
247 0.29
248 0.25
249 0.22
250 0.18
251 0.16
252 0.12
253 0.08
254 0.06
255 0.07
256 0.07
257 0.08
258 0.09
259 0.09
260 0.1
261 0.11
262 0.12
263 0.12
264 0.14
265 0.14
266 0.14
267 0.15
268 0.14
269 0.12
270 0.11
271 0.11
272 0.1
273 0.09
274 0.08
275 0.08
276 0.08
277 0.08
278 0.08
279 0.07
280 0.06
281 0.06
282 0.06
283 0.06
284 0.05
285 0.05
286 0.05
287 0.05
288 0.08
289 0.09
290 0.11
291 0.13
292 0.13
293 0.14
294 0.18
295 0.22
296 0.21
297 0.22
298 0.22
299 0.24
300 0.27
301 0.26
302 0.23
303 0.23
304 0.25
305 0.25
306 0.25
307 0.22
308 0.19
309 0.26
310 0.31
311 0.37
312 0.43
313 0.48
314 0.51
315 0.56
316 0.61
317 0.59
318 0.62
319 0.63
320 0.63
321 0.64
322 0.67
323 0.69
324 0.67
325 0.68
326 0.7
327 0.69
328 0.68
329 0.69
330 0.73
331 0.74
332 0.74
333 0.72
334 0.67
335 0.64
336 0.56
337 0.48
338 0.43