Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A428PBI2

Protein Details
Accession A0A428PBI2    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
56-90SCVCHDKGKVYHKHHKKCRCPKGERWHHIERQCKKBasic
NLS Segment(s)
Subcellular Location(s) mito 18, extr 4, vacu 2, cyto 1, pero 1, golg 1, cyto_pero 1
Family & Domain DBs
Amino Acid Sequences MTTFNMLFTRFFLGALVSMNSVNALPNPDANNQDVEARSLFHHCGKHASWSGDTKSCVCHDKGKVYHKHHKKCRCPKGERWHHIERQCKKH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.14
3 0.13
4 0.09
5 0.09
6 0.08
7 0.08
8 0.08
9 0.08
10 0.07
11 0.09
12 0.09
13 0.11
14 0.14
15 0.16
16 0.18
17 0.18
18 0.19
19 0.17
20 0.18
21 0.16
22 0.15
23 0.13
24 0.12
25 0.12
26 0.12
27 0.13
28 0.15
29 0.16
30 0.15
31 0.18
32 0.18
33 0.22
34 0.23
35 0.23
36 0.22
37 0.24
38 0.26
39 0.25
40 0.26
41 0.22
42 0.21
43 0.21
44 0.23
45 0.21
46 0.26
47 0.26
48 0.34
49 0.4
50 0.48
51 0.55
52 0.6
53 0.69
54 0.72
55 0.8
56 0.81
57 0.85
58 0.87
59 0.88
60 0.91
61 0.91
62 0.89
63 0.89
64 0.9
65 0.91
66 0.88
67 0.85
68 0.84
69 0.82
70 0.81
71 0.81