Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A428QCM9

Protein Details
Accession A0A428QCM9    Localization Confidence Low Confidence Score 9.6
NoLS Segment(s)
PositionSequenceProtein Nature
166-196ERAPYALTKKEKKKRRLREKRERAEREMKSSBasic
NLS Segment(s)
PositionSequence
174-191KKEKKKRRLREKRERAER
Subcellular Location(s) cysk 16, nucl 5, cyto 5, cyto_nucl 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR020850  GED_dom  
PROSITE View protein in PROSITE  
PS51388  GED  
Amino Acid Sequences MKRFIDDVAVEAIEGSLVTELGKLIDPVSVSMMSNNELNQVAGETETSKMLRKDLETELGVLKGGMAICRQFAGFGFLDLVRDGLDSDSDAEPEPDSDQDDVSDGESQVEAEAEAGAEDIPQEETPSMSDNAGQRSSSQDHLWDFGVVKPQPEADPEPPIGHYSLERAPYALTKKEKKKRRLREKRERAEREMKSSFPDTPPPFPEDDEAGMEKDFEDDPFNKWRVPIRKA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.08
2 0.06
3 0.04
4 0.04
5 0.04
6 0.04
7 0.05
8 0.06
9 0.07
10 0.07
11 0.07
12 0.08
13 0.08
14 0.09
15 0.11
16 0.11
17 0.11
18 0.12
19 0.13
20 0.13
21 0.14
22 0.13
23 0.13
24 0.12
25 0.12
26 0.11
27 0.1
28 0.09
29 0.08
30 0.08
31 0.07
32 0.08
33 0.1
34 0.1
35 0.13
36 0.14
37 0.15
38 0.17
39 0.18
40 0.22
41 0.23
42 0.27
43 0.24
44 0.24
45 0.23
46 0.21
47 0.19
48 0.14
49 0.11
50 0.08
51 0.08
52 0.07
53 0.07
54 0.07
55 0.07
56 0.08
57 0.08
58 0.07
59 0.07
60 0.11
61 0.1
62 0.09
63 0.11
64 0.1
65 0.11
66 0.11
67 0.1
68 0.06
69 0.06
70 0.06
71 0.05
72 0.05
73 0.04
74 0.07
75 0.07
76 0.08
77 0.08
78 0.08
79 0.08
80 0.08
81 0.09
82 0.07
83 0.08
84 0.08
85 0.07
86 0.07
87 0.08
88 0.07
89 0.07
90 0.08
91 0.06
92 0.06
93 0.06
94 0.06
95 0.05
96 0.05
97 0.04
98 0.03
99 0.03
100 0.03
101 0.03
102 0.03
103 0.03
104 0.03
105 0.03
106 0.03
107 0.04
108 0.04
109 0.04
110 0.04
111 0.04
112 0.05
113 0.07
114 0.08
115 0.07
116 0.1
117 0.11
118 0.14
119 0.15
120 0.14
121 0.12
122 0.16
123 0.18
124 0.18
125 0.16
126 0.16
127 0.16
128 0.18
129 0.18
130 0.14
131 0.13
132 0.12
133 0.19
134 0.17
135 0.16
136 0.15
137 0.16
138 0.16
139 0.18
140 0.21
141 0.17
142 0.2
143 0.21
144 0.21
145 0.21
146 0.22
147 0.19
148 0.15
149 0.13
150 0.13
151 0.15
152 0.17
153 0.16
154 0.15
155 0.15
156 0.19
157 0.23
158 0.26
159 0.3
160 0.37
161 0.48
162 0.57
163 0.67
164 0.73
165 0.8
166 0.85
167 0.89
168 0.91
169 0.92
170 0.94
171 0.95
172 0.96
173 0.96
174 0.92
175 0.89
176 0.88
177 0.81
178 0.78
179 0.7
180 0.6
181 0.54
182 0.49
183 0.44
184 0.37
185 0.43
186 0.39
187 0.41
188 0.43
189 0.41
190 0.4
191 0.38
192 0.38
193 0.31
194 0.29
195 0.27
196 0.25
197 0.23
198 0.21
199 0.19
200 0.16
201 0.15
202 0.13
203 0.11
204 0.14
205 0.14
206 0.18
207 0.26
208 0.28
209 0.27
210 0.29
211 0.38