Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A428P818

Protein Details
Accession A0A428P818    Localization Confidence High Confidence Score 17.2
NoLS Segment(s)
PositionSequenceProtein Nature
1-24MPKNRPSQNKRNAKKYGKLHAIRAHydrophilic
325-355DLRDDKLPWTRSRKKYKGRARWETARREFVRBasic
NLS Segment(s)
PositionSequence
10-17KRNAKKYG
335-351RSRKKYKGRARWETARR
Subcellular Location(s) nucl 14, mito 10, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR022085  OpdG  
Pfam View protein in Pfam  
PF12311  DUF3632  
Amino Acid Sequences MPKNRPSQNKRNAKKYGKLHAIRAQREHEAAKKVVDDESLDFPAKIDHLAKARRWFTADTTIIDKYMSDELSTAETVETLAKPVDEAYSSADFGRQWHKQEMIARGQRKFHSPEKALEMWGPEEDWQDPEMEWDASQSTEMLLWDLWYSILHAAKRIPYTDEARHEKLVELVRAFKARSNPPPPVPMTIPLKREWIWESGKLWTDLTVLGISVAEVSNDSPGCGAGWLWPELRAWENVNAFMARLTASHLMTFQSLGLWALRDATEQSLSPGYKRANSPSDNEILSHRVILASIWVMTAGEQVFAEYYLKIRDKRDIEVVDRILDLRDDKLPWTRSRKKYKGRARWETARREFVRRRFEVESRNESLPLEAREMASRTAKAMIPFVQFEEN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.87
2 0.85
3 0.85
4 0.85
5 0.81
6 0.79
7 0.76
8 0.77
9 0.74
10 0.72
11 0.66
12 0.59
13 0.58
14 0.55
15 0.53
16 0.5
17 0.45
18 0.41
19 0.38
20 0.35
21 0.32
22 0.29
23 0.24
24 0.21
25 0.24
26 0.25
27 0.23
28 0.22
29 0.2
30 0.2
31 0.18
32 0.18
33 0.15
34 0.17
35 0.24
36 0.3
37 0.36
38 0.43
39 0.45
40 0.45
41 0.46
42 0.44
43 0.41
44 0.44
45 0.41
46 0.35
47 0.36
48 0.34
49 0.31
50 0.29
51 0.24
52 0.17
53 0.18
54 0.15
55 0.12
56 0.11
57 0.12
58 0.15
59 0.15
60 0.12
61 0.09
62 0.09
63 0.09
64 0.11
65 0.1
66 0.08
67 0.09
68 0.08
69 0.08
70 0.09
71 0.09
72 0.08
73 0.09
74 0.12
75 0.13
76 0.14
77 0.14
78 0.15
79 0.14
80 0.16
81 0.22
82 0.22
83 0.25
84 0.29
85 0.3
86 0.32
87 0.38
88 0.42
89 0.45
90 0.48
91 0.5
92 0.49
93 0.53
94 0.51
95 0.51
96 0.5
97 0.47
98 0.49
99 0.46
100 0.47
101 0.49
102 0.48
103 0.43
104 0.39
105 0.34
106 0.25
107 0.22
108 0.18
109 0.13
110 0.12
111 0.12
112 0.12
113 0.11
114 0.1
115 0.1
116 0.11
117 0.11
118 0.1
119 0.09
120 0.09
121 0.09
122 0.08
123 0.08
124 0.07
125 0.05
126 0.06
127 0.06
128 0.06
129 0.05
130 0.05
131 0.05
132 0.05
133 0.05
134 0.05
135 0.05
136 0.07
137 0.1
138 0.1
139 0.11
140 0.12
141 0.15
142 0.17
143 0.17
144 0.17
145 0.18
146 0.23
147 0.26
148 0.33
149 0.35
150 0.37
151 0.37
152 0.35
153 0.32
154 0.31
155 0.3
156 0.24
157 0.19
158 0.19
159 0.19
160 0.2
161 0.2
162 0.18
163 0.21
164 0.25
165 0.32
166 0.35
167 0.38
168 0.38
169 0.42
170 0.41
171 0.38
172 0.34
173 0.3
174 0.32
175 0.32
176 0.32
177 0.29
178 0.31
179 0.28
180 0.29
181 0.26
182 0.24
183 0.22
184 0.22
185 0.22
186 0.22
187 0.23
188 0.21
189 0.19
190 0.15
191 0.13
192 0.11
193 0.1
194 0.07
195 0.06
196 0.05
197 0.05
198 0.04
199 0.04
200 0.04
201 0.03
202 0.03
203 0.04
204 0.05
205 0.05
206 0.06
207 0.05
208 0.05
209 0.05
210 0.05
211 0.05
212 0.06
213 0.08
214 0.09
215 0.09
216 0.1
217 0.1
218 0.11
219 0.13
220 0.12
221 0.12
222 0.15
223 0.15
224 0.15
225 0.16
226 0.15
227 0.13
228 0.12
229 0.1
230 0.06
231 0.06
232 0.08
233 0.1
234 0.1
235 0.1
236 0.1
237 0.11
238 0.11
239 0.11
240 0.08
241 0.06
242 0.06
243 0.06
244 0.06
245 0.06
246 0.05
247 0.06
248 0.06
249 0.07
250 0.08
251 0.09
252 0.09
253 0.09
254 0.11
255 0.14
256 0.14
257 0.14
258 0.18
259 0.18
260 0.21
261 0.24
262 0.28
263 0.31
264 0.33
265 0.37
266 0.36
267 0.37
268 0.33
269 0.32
270 0.28
271 0.24
272 0.22
273 0.18
274 0.14
275 0.11
276 0.1
277 0.09
278 0.08
279 0.06
280 0.06
281 0.06
282 0.06
283 0.06
284 0.06
285 0.08
286 0.07
287 0.07
288 0.06
289 0.07
290 0.07
291 0.08
292 0.08
293 0.06
294 0.08
295 0.13
296 0.18
297 0.21
298 0.23
299 0.31
300 0.33
301 0.37
302 0.44
303 0.42
304 0.42
305 0.45
306 0.44
307 0.37
308 0.35
309 0.31
310 0.24
311 0.21
312 0.18
313 0.13
314 0.15
315 0.15
316 0.17
317 0.25
318 0.29
319 0.36
320 0.46
321 0.54
322 0.61
323 0.71
324 0.79
325 0.82
326 0.87
327 0.91
328 0.91
329 0.92
330 0.92
331 0.9
332 0.9
333 0.89
334 0.89
335 0.85
336 0.85
337 0.78
338 0.77
339 0.77
340 0.75
341 0.77
342 0.69
343 0.67
344 0.64
345 0.66
346 0.66
347 0.65
348 0.64
349 0.59
350 0.58
351 0.52
352 0.46
353 0.42
354 0.38
355 0.32
356 0.28
357 0.24
358 0.23
359 0.26
360 0.28
361 0.29
362 0.28
363 0.26
364 0.24
365 0.27
366 0.28
367 0.26
368 0.28
369 0.29
370 0.29
371 0.3