Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A428Q8W6

Protein Details
Accession A0A428Q8W6    Localization Confidence Low Confidence Score 8.4
NoLS Segment(s)
PositionSequenceProtein Nature
311-330DAVRRGPRGRGKTRDGEKRVBasic
NLS Segment(s)
PositionSequence
314-328RRGPRGRGKTRDGEK
Subcellular Location(s) mito 14, cyto 10, nucl 1, extr 1, pero 1
Family & Domain DBs
InterPro View protein in InterPro  
IPR029058  AB_hydrolase  
Amino Acid Sequences MADTYATKGLPPPPAVSKKTLPMAGLLVDAYGLDELPHNKPVTCLWLLHPRTRTRARMHDIASRTIAAWNAHAGEAPERGLVALAFDMPNHGTRLVSKSANLAWNGGNASHAIDMMGMVKGGVTDMSGLMDLVAGYLGREVDGHVCLGWSLGGHSAWQAWFGEERIDAAVAVVGCPDFMSLMSDRAAIAKLDCGANFIGSKYFPNDLVKTCLRHDPKALLFGTSPIQPDQTRLKPILDARVRGKRLLLCSGAEDALVPYANSRPLATLLKEAVGEGGWYDGGFVLEDRVYDGVGHRFSAAMVEDAIKFLVDAVRRGPRGRGKTRDGEKRVL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.45
2 0.49
3 0.51
4 0.5
5 0.51
6 0.54
7 0.52
8 0.43
9 0.37
10 0.35
11 0.3
12 0.26
13 0.19
14 0.13
15 0.1
16 0.09
17 0.08
18 0.06
19 0.05
20 0.04
21 0.07
22 0.11
23 0.14
24 0.19
25 0.19
26 0.19
27 0.21
28 0.22
29 0.26
30 0.25
31 0.24
32 0.24
33 0.33
34 0.37
35 0.42
36 0.47
37 0.46
38 0.52
39 0.59
40 0.61
41 0.59
42 0.65
43 0.65
44 0.65
45 0.64
46 0.64
47 0.59
48 0.55
49 0.49
50 0.4
51 0.33
52 0.27
53 0.26
54 0.19
55 0.16
56 0.14
57 0.14
58 0.13
59 0.13
60 0.13
61 0.12
62 0.12
63 0.12
64 0.1
65 0.09
66 0.09
67 0.08
68 0.07
69 0.06
70 0.05
71 0.06
72 0.06
73 0.05
74 0.07
75 0.08
76 0.09
77 0.1
78 0.1
79 0.09
80 0.11
81 0.16
82 0.18
83 0.18
84 0.17
85 0.18
86 0.21
87 0.25
88 0.23
89 0.21
90 0.17
91 0.18
92 0.18
93 0.16
94 0.13
95 0.09
96 0.1
97 0.08
98 0.07
99 0.06
100 0.05
101 0.05
102 0.05
103 0.05
104 0.04
105 0.04
106 0.04
107 0.04
108 0.04
109 0.03
110 0.03
111 0.03
112 0.03
113 0.04
114 0.04
115 0.04
116 0.03
117 0.03
118 0.03
119 0.03
120 0.03
121 0.02
122 0.02
123 0.03
124 0.03
125 0.03
126 0.03
127 0.04
128 0.05
129 0.06
130 0.06
131 0.05
132 0.05
133 0.05
134 0.05
135 0.05
136 0.03
137 0.03
138 0.04
139 0.04
140 0.04
141 0.05
142 0.06
143 0.05
144 0.06
145 0.06
146 0.06
147 0.06
148 0.06
149 0.07
150 0.06
151 0.07
152 0.06
153 0.06
154 0.05
155 0.05
156 0.05
157 0.04
158 0.04
159 0.04
160 0.04
161 0.03
162 0.03
163 0.03
164 0.02
165 0.03
166 0.05
167 0.05
168 0.07
169 0.07
170 0.07
171 0.07
172 0.08
173 0.09
174 0.07
175 0.06
176 0.06
177 0.07
178 0.07
179 0.07
180 0.08
181 0.08
182 0.08
183 0.09
184 0.08
185 0.08
186 0.08
187 0.09
188 0.1
189 0.11
190 0.12
191 0.15
192 0.17
193 0.17
194 0.23
195 0.24
196 0.24
197 0.25
198 0.32
199 0.32
200 0.33
201 0.33
202 0.34
203 0.33
204 0.36
205 0.35
206 0.28
207 0.24
208 0.23
209 0.23
210 0.19
211 0.18
212 0.13
213 0.16
214 0.14
215 0.18
216 0.24
217 0.27
218 0.29
219 0.29
220 0.29
221 0.3
222 0.33
223 0.39
224 0.35
225 0.36
226 0.39
227 0.46
228 0.47
229 0.44
230 0.45
231 0.39
232 0.39
233 0.39
234 0.34
235 0.26
236 0.26
237 0.27
238 0.24
239 0.19
240 0.16
241 0.11
242 0.1
243 0.09
244 0.07
245 0.07
246 0.08
247 0.1
248 0.11
249 0.11
250 0.11
251 0.14
252 0.18
253 0.18
254 0.2
255 0.19
256 0.2
257 0.2
258 0.18
259 0.15
260 0.12
261 0.1
262 0.07
263 0.06
264 0.05
265 0.05
266 0.05
267 0.05
268 0.05
269 0.06
270 0.05
271 0.07
272 0.07
273 0.07
274 0.08
275 0.08
276 0.08
277 0.08
278 0.11
279 0.15
280 0.15
281 0.16
282 0.15
283 0.15
284 0.14
285 0.16
286 0.14
287 0.1
288 0.1
289 0.11
290 0.11
291 0.12
292 0.12
293 0.1
294 0.08
295 0.08
296 0.11
297 0.11
298 0.13
299 0.18
300 0.26
301 0.29
302 0.31
303 0.39
304 0.44
305 0.53
306 0.61
307 0.64
308 0.64
309 0.72
310 0.8
311 0.83