Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A428R2Y9

Protein Details
Accession A0A428R2Y9    Localization Confidence Low Confidence Score 9.1
NoLS Segment(s)
PositionSequenceProtein Nature
356-387DGERTEKKEQRWGHKKKPSWSQVRQRIPHLDEBasic
NLS Segment(s)
PositionSequence
367-372WGHKKK
Subcellular Location(s) cyto 9.5, cyto_nucl 7, nucl 3.5, mito 3, plas 3, pero 3, E.R. 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR017939  G-Glutamylcylcotransferase  
Gene Ontology GO:0016020  C:membrane  
GO:0003839  F:gamma-glutamylcyclotransferase activity  
Amino Acid Sequences MSEHEQQPGAASAVSDAATKTCALASLCKVSAAQRPEPEPTLAPKYPSVSSIPRTSAERLAQAAEDVVDDPNHPKPNTYLYLAYGSNMCAQTFLGMRGIRPLSQVNVSVPTLELKFDLPGIPYREPCFANVGYRKMPDKPKLPPKIPFDPPQPPHSESKWDEGLLGVVYEVTEDDYKTIIRTEGGGTGYKQIMVPCLPLPPKISIPEKPFPEIPKPFLAKTLFAPQIPDSDLPDDPRKKKWWYRFLIHPVREPGYAQPSLRYLNLIRDGAKEHDLPEGYQRWLNAMPTYTITNWRQRIGAVVYLIISLVFFAIMSLSGPLADKEGKLPRWLALATTVFFNISWVEYDGILKPVFGDGERTEKKEQRWGHKKKPSWSQVRQRIPHLDEEKVGLLKEFE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.11
3 0.09
4 0.09
5 0.1
6 0.1
7 0.1
8 0.09
9 0.11
10 0.12
11 0.17
12 0.2
13 0.26
14 0.26
15 0.26
16 0.27
17 0.28
18 0.34
19 0.35
20 0.37
21 0.36
22 0.39
23 0.43
24 0.45
25 0.44
26 0.4
27 0.4
28 0.42
29 0.38
30 0.37
31 0.36
32 0.36
33 0.35
34 0.34
35 0.33
36 0.31
37 0.34
38 0.36
39 0.36
40 0.35
41 0.38
42 0.39
43 0.4
44 0.37
45 0.35
46 0.31
47 0.29
48 0.27
49 0.23
50 0.2
51 0.14
52 0.12
53 0.1
54 0.09
55 0.08
56 0.09
57 0.11
58 0.18
59 0.24
60 0.23
61 0.23
62 0.25
63 0.32
64 0.35
65 0.35
66 0.3
67 0.27
68 0.3
69 0.29
70 0.27
71 0.21
72 0.18
73 0.2
74 0.19
75 0.16
76 0.12
77 0.12
78 0.14
79 0.14
80 0.14
81 0.14
82 0.14
83 0.14
84 0.19
85 0.21
86 0.19
87 0.21
88 0.21
89 0.19
90 0.2
91 0.22
92 0.17
93 0.19
94 0.19
95 0.17
96 0.16
97 0.15
98 0.14
99 0.13
100 0.12
101 0.09
102 0.09
103 0.1
104 0.1
105 0.09
106 0.14
107 0.18
108 0.2
109 0.22
110 0.24
111 0.27
112 0.26
113 0.26
114 0.26
115 0.22
116 0.27
117 0.29
118 0.31
119 0.3
120 0.32
121 0.33
122 0.35
123 0.42
124 0.41
125 0.43
126 0.48
127 0.56
128 0.62
129 0.65
130 0.66
131 0.65
132 0.67
133 0.66
134 0.63
135 0.59
136 0.6
137 0.58
138 0.55
139 0.54
140 0.48
141 0.47
142 0.43
143 0.44
144 0.37
145 0.39
146 0.35
147 0.3
148 0.27
149 0.22
150 0.21
151 0.13
152 0.11
153 0.06
154 0.04
155 0.04
156 0.03
157 0.03
158 0.04
159 0.04
160 0.04
161 0.05
162 0.05
163 0.06
164 0.06
165 0.07
166 0.06
167 0.06
168 0.07
169 0.07
170 0.09
171 0.1
172 0.11
173 0.11
174 0.13
175 0.13
176 0.12
177 0.12
178 0.1
179 0.1
180 0.09
181 0.1
182 0.09
183 0.12
184 0.13
185 0.13
186 0.15
187 0.15
188 0.17
189 0.19
190 0.22
191 0.24
192 0.3
193 0.34
194 0.34
195 0.34
196 0.35
197 0.35
198 0.39
199 0.36
200 0.33
201 0.33
202 0.34
203 0.32
204 0.34
205 0.32
206 0.26
207 0.25
208 0.29
209 0.25
210 0.23
211 0.25
212 0.2
213 0.21
214 0.21
215 0.2
216 0.14
217 0.14
218 0.15
219 0.17
220 0.24
221 0.29
222 0.3
223 0.35
224 0.39
225 0.44
226 0.52
227 0.59
228 0.61
229 0.61
230 0.64
231 0.68
232 0.73
233 0.75
234 0.7
235 0.64
236 0.58
237 0.53
238 0.47
239 0.39
240 0.31
241 0.27
242 0.27
243 0.23
244 0.2
245 0.2
246 0.22
247 0.21
248 0.2
249 0.15
250 0.19
251 0.23
252 0.22
253 0.21
254 0.21
255 0.23
256 0.23
257 0.25
258 0.21
259 0.17
260 0.2
261 0.19
262 0.19
263 0.22
264 0.22
265 0.21
266 0.22
267 0.21
268 0.2
269 0.21
270 0.21
271 0.17
272 0.15
273 0.15
274 0.15
275 0.18
276 0.16
277 0.21
278 0.24
279 0.31
280 0.32
281 0.32
282 0.31
283 0.29
284 0.32
285 0.28
286 0.27
287 0.19
288 0.17
289 0.16
290 0.15
291 0.15
292 0.1
293 0.07
294 0.04
295 0.04
296 0.03
297 0.03
298 0.03
299 0.03
300 0.03
301 0.04
302 0.04
303 0.04
304 0.05
305 0.05
306 0.05
307 0.08
308 0.09
309 0.09
310 0.15
311 0.23
312 0.24
313 0.27
314 0.28
315 0.26
316 0.29
317 0.29
318 0.24
319 0.22
320 0.23
321 0.2
322 0.2
323 0.19
324 0.16
325 0.16
326 0.16
327 0.1
328 0.09
329 0.1
330 0.1
331 0.11
332 0.11
333 0.13
334 0.14
335 0.16
336 0.15
337 0.13
338 0.12
339 0.12
340 0.13
341 0.11
342 0.15
343 0.14
344 0.24
345 0.28
346 0.32
347 0.39
348 0.44
349 0.47
350 0.52
351 0.58
352 0.59
353 0.67
354 0.72
355 0.76
356 0.8
357 0.85
358 0.85
359 0.87
360 0.87
361 0.86
362 0.87
363 0.87
364 0.88
365 0.9
366 0.87
367 0.83
368 0.82
369 0.75
370 0.74
371 0.67
372 0.6
373 0.51
374 0.49
375 0.45
376 0.37
377 0.34