Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E2LB98

Protein Details
Accession E2LB98    Localization Confidence Low Confidence Score 7.4
NoLS Segment(s)
PositionSequenceProtein Nature
1-23KKTVPDGTKPPRPRKTIRHDSSSBasic
NLS Segment(s)
Subcellular Location(s) nucl 10, cyto_nucl 9.833, cyto 8.5, mito_nucl 8.333, mito 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR027005  GlyclTrfase_39-like  
IPR003342  Glyco_trans_39/83  
Gene Ontology GO:0016020  C:membrane  
GO:0004169  F:dolichyl-phosphate-mannose-protein mannosyltransferase activity  
KEGG mpr:MPER_03413  -  
Pfam View protein in Pfam  
PF02366  PMT  
Amino Acid Sequences KKTVPDGTKPPRPRKTIRHDSSSSKVFLMKKGFLFNVENKLSPGVHDEPGIDIVVWDEAHFGKFGSHYLKREFYFDVHPPLGKMLVGLAGLLSGYDGSFDFKSGTEYPQHVPGGVGLESVGVSFGDLDGLIR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.82
2 0.83
3 0.84
4 0.81
5 0.79
6 0.75
7 0.75
8 0.73
9 0.67
10 0.57
11 0.46
12 0.45
13 0.38
14 0.38
15 0.36
16 0.33
17 0.31
18 0.33
19 0.32
20 0.3
21 0.32
22 0.3
23 0.33
24 0.31
25 0.29
26 0.26
27 0.27
28 0.24
29 0.2
30 0.22
31 0.17
32 0.16
33 0.16
34 0.15
35 0.15
36 0.16
37 0.15
38 0.09
39 0.06
40 0.06
41 0.06
42 0.06
43 0.05
44 0.05
45 0.05
46 0.05
47 0.06
48 0.05
49 0.05
50 0.05
51 0.07
52 0.12
53 0.14
54 0.16
55 0.19
56 0.23
57 0.23
58 0.25
59 0.25
60 0.22
61 0.24
62 0.24
63 0.26
64 0.23
65 0.22
66 0.2
67 0.2
68 0.18
69 0.13
70 0.11
71 0.06
72 0.06
73 0.05
74 0.05
75 0.04
76 0.04
77 0.03
78 0.03
79 0.03
80 0.02
81 0.02
82 0.03
83 0.03
84 0.06
85 0.07
86 0.07
87 0.08
88 0.08
89 0.13
90 0.14
91 0.16
92 0.18
93 0.2
94 0.22
95 0.28
96 0.28
97 0.23
98 0.22
99 0.21
100 0.2
101 0.17
102 0.15
103 0.09
104 0.09
105 0.09
106 0.08
107 0.08
108 0.04
109 0.04
110 0.04
111 0.04
112 0.04