Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A428PG35

Protein Details
Accession A0A428PG35    Localization Confidence Medium Confidence Score 12.9
NoLS Segment(s)
PositionSequenceProtein Nature
45-64KSFRTKQKLAKAQKQNRPVPHydrophilic
70-91RTGNTIRYNSKRRHWRKTRIGIHydrophilic
NLS Segment(s)
PositionSequence
80-86KRRHWRK
Subcellular Location(s) mito 16, nucl 8, cyto 1, plas 1, pero 1, cyto_pero 1
Family & Domain DBs
InterPro View protein in InterPro  
IPR000077  Ribosomal_L39  
IPR023626  Ribosomal_L39e_dom_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00832  Ribosomal_L39  
Amino Acid Sequences MAALPCLAPLKRASQSVDNEKYTRMDFLPSAGPDAMTLRGCASHKSFRTKQKLAKAQKQNRPVPQWIRLRTGNTIRYNSKRRHWRKTRIGI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.33
2 0.4
3 0.48
4 0.52
5 0.5
6 0.47
7 0.46
8 0.44
9 0.37
10 0.32
11 0.23
12 0.19
13 0.15
14 0.17
15 0.2
16 0.17
17 0.19
18 0.16
19 0.16
20 0.13
21 0.14
22 0.14
23 0.1
24 0.1
25 0.08
26 0.1
27 0.11
28 0.12
29 0.15
30 0.2
31 0.23
32 0.31
33 0.37
34 0.44
35 0.52
36 0.56
37 0.59
38 0.62
39 0.69
40 0.69
41 0.73
42 0.75
43 0.76
44 0.78
45 0.81
46 0.79
47 0.77
48 0.74
49 0.72
50 0.67
51 0.66
52 0.67
53 0.61
54 0.59
55 0.56
56 0.53
57 0.52
58 0.54
59 0.54
60 0.51
61 0.53
62 0.54
63 0.6
64 0.65
65 0.65
66 0.67
67 0.7
68 0.74
69 0.79
70 0.82
71 0.84